BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0911 (678 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC869.07c |mel1||alpha-galactosidase |Schizosaccharomyces pomb... 27 3.3 SPAC11H11.04 |mam2||pheromone p-factor receptor|Schizosaccharomy... 25 7.6 >SPAC869.07c |mel1||alpha-galactosidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 436 Score = 26.6 bits (56), Expect = 3.3 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -2 Query: 173 RVWRFGKYTIKYNSKRFYSY 114 +VWRF +Y +K + +F+S+ Sbjct: 414 QVWRFQQYKVKNTNDKFFSF 433 >SPAC11H11.04 |mam2||pheromone p-factor receptor|Schizosaccharomyces pombe|chr 1|||Manual Length = 348 Score = 25.4 bits (53), Expect = 7.6 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +2 Query: 149 CIYQIATHVSLLENIIILIK*YLEASNVISFHYVNMSNYLIFLLAVIILVEKE 307 C+ I V++ N ++ Y N++ YV++ N LI LLA +I+ E Sbjct: 91 CLRAILNIVTICSNSYSILVNYGFILNMVHM-YVHVFNILILLLAPVIIFTAE 142 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,203,472 Number of Sequences: 5004 Number of extensions: 38149 Number of successful extensions: 46 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -