BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0911 (678 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30360.1 68414.m03712 early-responsive to dehydration stress ... 27 8.6 >At1g30360.1 68414.m03712 early-responsive to dehydration stress protein (ERD4) nearly identical to ERD4 protein (early-responsive to dehydration stress) [Arabidopsis thaliana] GI:15375406; contains Pfam profile PF02714: Domain of unknown function DUF221 Length = 724 Score = 27.5 bits (58), Expect = 8.6 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 7/50 (14%) Frame = +1 Query: 379 WVKIKXFMKKLFRAQCVLV------HNKTYFIGFESNXF-SILYITKALN 507 W K++ + KKL RA+ +L NKT F G SI Y T+ +N Sbjct: 240 WEKLEGYKKKLARAEAILAATNNRPTNKTGFCGLVGKQVDSIEYYTELIN 289 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,432,763 Number of Sequences: 28952 Number of extensions: 163078 Number of successful extensions: 229 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 229 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -