BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0907 (673 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 119 1e-28 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 5.0 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 24 5.0 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 5.0 AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.8 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.8 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.8 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.8 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.8 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.8 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 8.8 AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A... 23 8.8 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 119 bits (286), Expect = 1e-28 Identities = 53/90 (58%), Positives = 66/90 (73%) Frame = +1 Query: 250 HLNKDKFQVNLDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENC 429 +++KDKFQ+NLDVQ FSPEEISVK D V+VEGKHEE+QD+HGY+SR F RRY LP+ Sbjct: 9 NISKDKFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRYMLPKGH 68 Query: 430 NPDTVESRLSSDGVLTVIAPRTPAATRTSE 519 N + S LSSDG+LT+ PR + E Sbjct: 69 NEADIVSSLSSDGILTITCPRKEIEQKNEE 98 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 5.0 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -1 Query: 583 STSAVGSLISFXTGPV*VMGTARSFSWQPESWERSR 476 +T+A+G + + G V + + SW P W+ S+ Sbjct: 2754 ATAAIGVITATSVGFAYVSIASANGSWDPSKWDWSQ 2789 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 23.8 bits (49), Expect = 5.0 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = +3 Query: 489 QDSGCHENERAVPITQTGPVXKEIKEPTAEVESNRNKXMTLRNACES 629 QD+G RA T P + EP E +SN+ L N S Sbjct: 47 QDTGFEPQTRARSNTWPLPRPENFVEPETEPDSNKCSNQQLANTGSS 93 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 5.0 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 510 SRGSRSPGSDHGQHAVRGQPRFDSVG 433 S SR GSD G H++ + D G Sbjct: 1349 STSSRGSGSDSGSHSISSAAQHDFQG 1374 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 105 RTAFAIRTSDWRLLRTI 155 R FA+R + WR +RTI Sbjct: 6 RALFAMRDTRWRNMRTI 22 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 105 RTAFAIRTSDWRLLRTI 155 R FA+R + WR +RTI Sbjct: 6 RALFAMRDTRWRNMRTI 22 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 105 RTAFAIRTSDWRLLRTI 155 R FA+R + WR +RTI Sbjct: 6 RALFAMRDTRWRNMRTI 22 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 105 RTAFAIRTSDWRLLRTI 155 R FA+R + WR +RTI Sbjct: 6 RALFAMRDTRWRNMRTI 22 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 105 RTAFAIRTSDWRLLRTI 155 R FA+R + WR +RTI Sbjct: 6 RALFAMRDTRWRNMRTI 22 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 105 RTAFAIRTSDWRLLRTI 155 R FA+R + WR +RTI Sbjct: 6 RALFAMRDTRWRNMRTI 22 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 105 RTAFAIRTSDWRLLRTI 155 R FA+R + WR +RTI Sbjct: 126 RALFAMRDTRWRNMRTI 142 >AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A protein. Length = 433 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 548 PEGD*GAHCGS 580 P GD GAHCG+ Sbjct: 321 PYGDTGAHCGN 331 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 628,874 Number of Sequences: 2352 Number of extensions: 11701 Number of successful extensions: 30 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -