BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0901 (674 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12784| Best HMM Match : ADAM_spacer1 (HMM E-Value=1.4e-23) 29 4.5 >SB_12784| Best HMM Match : ADAM_spacer1 (HMM E-Value=1.4e-23) Length = 571 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/53 (28%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = +3 Query: 180 ISEGVYAPPCFFYEERT-FVGPEAFPFDQDRWASTGLARRGST*CETVNGSHS 335 +S G PP Y F+GP F + RW +G E +N H+ Sbjct: 505 LSVGKLTPPNVHYSLNVPFIGPHKFKWIIKRWTPCNRLCQGGARSEKINAQHT 557 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,945,386 Number of Sequences: 59808 Number of extensions: 410669 Number of successful extensions: 649 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -