BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0901 (674 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g32530.1 68415.m03974 cellulose synthase family protein simil... 30 1.2 At2g32610.1 68415.m03981 cellulose synthase family protein simil... 28 5.0 >At2g32530.1 68415.m03974 cellulose synthase family protein similar to cellulose synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] Length = 755 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = -3 Query: 312 HTR-WSLSWLSPCSPTYLGQMERPPGQQKSFLHKK 211 H+R W+ S++SP P +LG M PPG ++ L ++ Sbjct: 469 HSRGWTSSYISPKPPAFLGAM--PPGGPEAMLQQR 501 >At2g32610.1 68415.m03981 cellulose synthase family protein similar to Zea mays cellulose synthase-3 [gi:9622878], -2 [gi:9622876], -1 [gi:9622874] Length = 757 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = -3 Query: 312 HTR-WSLSWLSPCSPTYLGQMERPPGQQKSFLHKK 211 H+R W+ S++SP +P +LG M P G ++ L ++ Sbjct: 470 HSRGWTSSYISPDTPAFLGSM--PAGVPEALLQQR 502 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,083,425 Number of Sequences: 28952 Number of extensions: 294160 Number of successful extensions: 436 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 436 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -