BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0899 (637 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56418| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-35) 28 7.3 SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) 28 7.3 >SB_56418| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-35) Length = 1898 Score = 27.9 bits (59), Expect = 7.3 Identities = 18/62 (29%), Positives = 26/62 (41%) Frame = -2 Query: 558 KGQRXAXRRDXARQ*RLIIMLSAQTCKRYACIYFDTASIAPLSXAIVKHTKYLS*LDTSY 379 KGQR + R + + + A TC YAC D A++ + + Y L Y Sbjct: 991 KGQRREAQSTLERPAQKLRPVEAITCAPYACFDADVATMGNCLKFLAECCWYYKLLSFEY 1050 Query: 378 IT 373 IT Sbjct: 1051 IT 1052 >SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) Length = 3999 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = -3 Query: 380 ISQILKMPLHVXNIFIIPLLRSYYLITHQLSASEH 276 ++ +L PL++ +I I P R+ + I++ LSA H Sbjct: 229 VTCVLPSPLYIHHIRIFPYCRNGFRISYTLSADLH 263 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,360,893 Number of Sequences: 59808 Number of extensions: 270900 Number of successful extensions: 365 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 365 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -