BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0895 (677 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146736-1|AAO12096.1| 131|Anopheles gambiae odorant-binding pr... 52 1e-08 AJ697723-1|CAG26916.1| 131|Anopheles gambiae putative odorant-b... 52 1e-08 AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-b... 40 5e-05 AY146733-1|AAO12093.1| 131|Anopheles gambiae odorant-binding pr... 38 4e-04 AJ697724-1|CAG26917.1| 131|Anopheles gambiae putative odorant-b... 38 4e-04 AY146738-1|AAO12098.1| 134|Anopheles gambiae odorant-binding pr... 36 0.001 AY146727-1|AAO12087.1| 139|Anopheles gambiae odorant-binding pr... 34 0.005 AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding pr... 33 0.008 AY146731-1|AAO12091.1| 150|Anopheles gambiae odorant-binding pr... 31 0.044 AF437887-1|AAL84182.1| 150|Anopheles gambiae odorant binding pr... 31 0.044 AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding pr... 28 0.24 AY146722-1|AAO12082.1| 107|Anopheles gambiae odorant-binding pr... 27 0.72 AY146720-1|AAO12080.1| 147|Anopheles gambiae odorant-binding pr... 27 0.72 AF437885-1|AAL84180.1| 157|Anopheles gambiae odorant binding pr... 25 1.7 AY146719-1|AAO12079.1| 159|Anopheles gambiae odorant-binding pr... 25 2.2 DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. 24 3.8 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 24 3.8 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 23 6.7 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 23 6.7 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 23 6.7 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 23 6.7 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 23 6.7 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 23 6.7 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 23 6.7 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 23 6.7 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 23 6.7 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 23 6.7 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 23 6.7 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 23 6.7 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 23 6.7 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 23 6.7 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 23 6.7 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 23 6.7 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 23 6.7 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 23 6.7 EF588665-1|ABQ96851.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588664-1|ABQ96850.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588663-1|ABQ96849.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588662-1|ABQ96848.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588661-1|ABQ96847.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588660-1|ABQ96846.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588659-1|ABQ96845.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588658-1|ABQ96844.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588657-1|ABQ96843.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588656-1|ABQ96842.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588655-1|ABQ96841.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588654-1|ABQ96840.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588653-1|ABQ96839.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588651-1|ABQ96838.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588650-1|ABQ96837.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588649-1|ABQ96836.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588647-1|ABQ96835.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588646-1|ABQ96834.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588645-1|ABQ96833.1| 161|Anopheles gambiae transposase protein. 23 8.9 EF588642-1|ABQ96832.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588641-1|ABQ96831.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588640-1|ABQ96830.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588639-1|ABQ96829.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588638-1|ABQ96828.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588637-1|ABQ96827.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588636-1|ABQ96826.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588635-1|ABQ96825.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588634-1|ABQ96824.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588633-1|ABQ96823.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588632-1|ABQ96822.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588631-1|ABQ96821.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588630-1|ABQ96820.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588629-1|ABQ96819.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588628-1|ABQ96818.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588627-1|ABQ96817.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588626-1|ABQ96816.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588625-1|ABQ96815.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588624-1|ABQ96814.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588623-1|ABQ96813.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588622-1|ABQ96812.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588621-1|ABQ96811.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588620-1|ABQ96810.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588618-1|ABQ96809.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588617-1|ABQ96808.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588616-1|ABQ96807.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588615-1|ABQ96806.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588614-1|ABQ96805.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588613-1|ABQ96804.1| 161|Anopheles gambiae transposase protein. 23 8.9 EF588612-1|ABQ96803.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588611-1|ABQ96802.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588610-1|ABQ96801.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588609-1|ABQ96800.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588608-1|ABQ96799.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588607-1|ABQ96798.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588606-1|ABQ96797.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588605-1|ABQ96796.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588604-1|ABQ96795.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588603-1|ABQ96794.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588602-1|ABQ96793.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588601-1|ABQ96792.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588600-1|ABQ96791.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588599-1|ABQ96790.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588598-1|ABQ96789.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588597-1|ABQ96788.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588596-1|ABQ96787.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588595-1|ABQ96786.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588591-1|ABQ96785.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588590-1|ABQ96784.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588589-1|ABQ96783.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588588-1|ABQ96782.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588587-1|ABQ96781.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588586-1|ABQ96780.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588585-1|ABQ96779.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588584-1|ABQ96778.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588583-1|ABQ96777.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588582-1|ABQ96776.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588581-1|ABQ96775.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588580-1|ABQ96774.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588579-1|ABQ96773.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588577-1|ABQ96772.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588576-1|ABQ96771.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588574-1|ABQ96770.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588571-1|ABQ96769.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588570-1|ABQ96768.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588569-1|ABQ96767.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588568-1|ABQ96766.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588567-1|ABQ96765.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588566-1|ABQ96764.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588565-1|ABQ96763.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588564-1|ABQ96762.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588563-1|ABQ96761.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588562-1|ABQ96760.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588561-1|ABQ96759.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588560-1|ABQ96758.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588559-1|ABQ96757.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588558-1|ABQ96756.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588557-1|ABQ96755.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588556-1|ABQ96754.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588555-1|ABQ96753.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588554-1|ABQ96752.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588553-1|ABQ96751.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588551-1|ABQ63507.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588550-1|ABQ63506.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588549-1|ABQ63505.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588548-1|ABQ63504.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588547-1|ABQ63503.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588546-1|ABQ63502.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588545-1|ABQ63501.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588544-1|ABQ63500.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588543-1|ABQ63499.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588542-1|ABQ63498.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588541-1|ABQ63497.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588540-1|ABQ63496.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588539-1|ABQ63495.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588538-1|ABQ63494.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588537-1|ABQ63493.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588536-1|ABQ63492.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588535-1|ABQ63491.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588534-1|ABQ63490.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588533-1|ABQ63489.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588532-1|ABQ63488.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588531-1|ABQ63487.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588530-1|ABQ63486.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588529-1|ABQ63485.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588528-1|ABQ63484.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588527-1|ABQ63483.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588526-1|ABQ63482.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588525-1|ABQ63481.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588524-1|ABQ63480.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588523-1|ABQ63479.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588522-1|ABQ63478.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588521-1|ABQ63477.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588520-1|ABQ63476.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588519-1|ABQ63475.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588518-1|ABQ96750.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588517-1|ABQ96749.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588516-1|ABQ96748.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588515-1|ABQ96747.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588514-1|ABQ96746.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588512-1|ABQ96745.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588509-1|ABQ96744.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588508-1|ABQ96743.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588507-1|ABQ96742.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588506-1|ABQ96741.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588505-1|ABQ96740.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588504-1|ABQ96739.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588502-1|ABQ96737.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588501-1|ABQ96736.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588500-1|ABQ96735.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588499-1|ABQ96734.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588498-1|ABQ96733.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588497-1|ABQ96732.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588496-1|ABQ96731.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588494-1|ABQ96730.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588493-1|ABQ96729.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588492-1|ABQ96728.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588491-1|ABQ96727.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588490-1|ABQ96726.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588489-1|ABQ96725.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588488-1|ABQ96724.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588487-1|ABQ96723.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588486-1|ABQ96722.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588485-1|ABQ96721.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588484-1|ABQ96720.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588483-1|ABQ96719.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588482-1|ABQ96718.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588481-1|ABQ96717.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588480-1|ABQ96716.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588479-1|ABQ96715.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588478-1|ABQ96714.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588477-1|ABQ96713.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588476-1|ABQ96712.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588475-1|ABQ96711.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588474-1|ABQ96710.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588473-1|ABQ96709.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588472-1|ABQ96708.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588471-1|ABQ96707.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588470-1|ABQ96706.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588469-1|ABQ96705.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588467-1|ABQ96703.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588466-1|ABQ96702.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588465-1|ABQ96701.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588464-1|ABQ96700.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588463-1|ABQ96699.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588462-1|ABQ96698.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588461-1|ABQ96697.1| 176|Anopheles gambiae transposase protein. 23 8.9 EF588460-1|ABQ96696.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588459-1|ABQ96695.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588458-1|ABQ96694.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588457-1|ABQ96693.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588456-1|ABQ96692.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588455-1|ABQ96691.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588454-1|ABQ96690.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588453-1|ABQ96689.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588452-1|ABQ96688.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588451-1|ABQ96687.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588450-1|ABQ96686.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588449-1|ABQ96685.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588448-1|ABQ96684.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588447-1|ABQ96683.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588446-1|ABQ96682.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588445-1|ABQ96681.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588444-1|ABQ96680.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588443-1|ABQ96679.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588442-1|ABQ96678.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588441-1|ABQ96677.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588440-1|ABQ96676.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588439-1|ABQ96675.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588438-1|ABQ96674.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588437-1|ABQ96673.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588436-1|ABQ96672.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588435-1|ABQ96671.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588434-1|ABQ96670.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588433-1|ABQ96669.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588432-1|ABQ96668.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588431-1|ABQ96667.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588430-1|ABQ96666.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588429-1|ABQ96665.1| 177|Anopheles gambiae transposase protein. 23 8.9 EF588428-1|ABQ96664.1| 177|Anopheles gambiae transposase protein. 23 8.9 AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 23 8.9 AF513638-1|AAM53610.1| 210|Anopheles gambiae glutathione S-tran... 23 8.9 >AY146736-1|AAO12096.1| 131|Anopheles gambiae odorant-binding protein AgamOBP26 protein. Length = 131 Score = 52.4 bits (120), Expect = 1e-08 Identities = 28/85 (32%), Positives = 46/85 (54%), Gaps = 2/85 (2%) Frame = +3 Query: 15 MKTFIVFVVCVVLAQ--ALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPL 188 MKTF+ V ++A ALT +QK+ + + A+C+ T + KLK GDF ++ Sbjct: 1 MKTFVAIAVVALIAGTFALTIDQKKKAEGYAAECVKTTGVPPETAAKLKGGDFAGADDKT 60 Query: 189 KKYALCMLIKSQLMTKDGKFKKTSL 263 K +A C L K+ MT G+ + ++ Sbjct: 61 KCFAKCFLEKAGFMTDKGEIDEKTV 85 >AJ697723-1|CAG26916.1| 131|Anopheles gambiae putative odorant-binding protein OBPjj13 protein. Length = 131 Score = 52.4 bits (120), Expect = 1e-08 Identities = 28/85 (32%), Positives = 46/85 (54%), Gaps = 2/85 (2%) Frame = +3 Query: 15 MKTFIVFVVCVVLAQ--ALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPL 188 MKTF+ V ++A ALT +QK+ + + A+C+ T + KLK GDF ++ Sbjct: 1 MKTFVAIAVVALIAGTFALTIDQKKKAEGYAAECVKTTGVPPETAAKLKGGDFAGADDKT 60 Query: 189 KKYALCMLIKSQLMTKDGKFKKTSL 263 K +A C L K+ MT G+ + ++ Sbjct: 61 KCFAKCFLEKAGFMTDKGEIDEKTV 85 >AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-binding protein OBPjj11 protein. Length = 135 Score = 40.3 bits (90), Expect = 5e-05 Identities = 20/80 (25%), Positives = 40/80 (50%) Frame = +3 Query: 33 FVVCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCML 212 F+ C V +++EQ+E ++ C+ +T A E VN+L++GD + + + + C Sbjct: 13 FIACAVAT--ISEEQREAARQLAGKCMQQTGASEDDVNRLRSGDTEGADRNTRCFVQCFF 70 Query: 213 IKSQLMTKDGKFKKTSLWLK 272 + + +DG + L K Sbjct: 71 QGAGFVDQDGSVQTDELTQK 90 >AY146733-1|AAO12093.1| 131|Anopheles gambiae odorant-binding protein AgamOBP23 protein. Length = 131 Score = 37.5 bits (83), Expect = 4e-04 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 3/82 (3%) Frame = +3 Query: 15 MKTFIV---FVVCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEP 185 MK+F F + V A T Q++ + +C++ET + + KL+ GD + Sbjct: 1 MKSFFCVASFFLLVASVHAFTLRQQKMVSIFALECMAETGIGAESLTKLRDGDLTANDRT 60 Query: 186 LKKYALCMLIKSQLMTKDGKFK 251 K + C K M +GK + Sbjct: 61 AKCFMKCFFEKENFMDAEGKLQ 82 >AJ697724-1|CAG26917.1| 131|Anopheles gambiae putative odorant-binding protein OBPjj14 protein. Length = 131 Score = 37.5 bits (83), Expect = 4e-04 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 3/82 (3%) Frame = +3 Query: 15 MKTFIV---FVVCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEP 185 MK+F F + V A T Q++ + +C++ET + + KL+ GD + Sbjct: 1 MKSFFCVASFFLLVASVHAFTLRQQKMVSIFALECMAETGIGAESLTKLRDGDLTANDRT 60 Query: 186 LKKYALCMLIKSQLMTKDGKFK 251 K + C K M +GK + Sbjct: 61 AKCFMKCFFEKENFMDAEGKLQ 82 >AY146738-1|AAO12098.1| 134|Anopheles gambiae odorant-binding protein AgamOBP28 protein. Length = 134 Score = 35.9 bits (79), Expect = 0.001 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = +3 Query: 27 IVFVVCVVLAQALTDEQKENLKKHRADCLSETKA--DEQLVNKLKTGDFKTENEPLKKYA 200 ++ VC AQ LTD+Q + + CL + K E LV L+ GDF + K + Sbjct: 8 VLLAVCAA-AQPLTDDQMKKAEGFALGCLEQHKGLNKEHLV-LLRDGDFSKVDADTKCFL 65 Query: 201 LCMLIKSQLMTKDGKFK 251 C L ++ M GK + Sbjct: 66 RCFLQQANFMDAAGKLQ 82 >AY146727-1|AAO12087.1| 139|Anopheles gambiae odorant-binding protein AgamOBP20 protein. Length = 139 Score = 33.9 bits (74), Expect = 0.005 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +3 Query: 99 RADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTK 236 R+ CL +TK E+LVN L+ F E LK Y C++ Q M K Sbjct: 33 RSVCLGKTKVAEELVNGLRESKFADVKE-LKCYVNCVMEMMQTMKK 77 >AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding protein AgamOBP21 protein. Length = 131 Score = 33.1 bits (72), Expect = 0.008 Identities = 26/84 (30%), Positives = 35/84 (41%), Gaps = 2/84 (2%) Frame = +3 Query: 27 IVFVVCVVLAQALTDEQKENLKKHRADCLSETKAD--EQLVNKLKTGDFKTENEPLKKYA 200 IVFVV +LA T EQ E K C +E + E K++ GD ++E K Sbjct: 6 IVFVV--LLAAVSTMEQHEIAKSLAEQCRAELGGELPEDFATKMRLGDLTLDSETAKCTI 63 Query: 201 LCMLIKSQLMTKDGKFKKTSLWLK 272 CM K + G + L K Sbjct: 64 QCMFAKVGFTLESGAANRDVLIAK 87 Score = 31.9 bits (69), Expect = 0.019 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +2 Query: 254 DVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWNYVKCYHE 385 DV +AK+ K E D C N+G + ++ +CYH+ Sbjct: 82 DVLIAKLSKGNPTAKAEAFADVCENNEGETACDKAFSLYQCYHK 125 >AY146731-1|AAO12091.1| 150|Anopheles gambiae odorant-binding protein AgamOBP4 protein. Length = 150 Score = 30.7 bits (66), Expect = 0.044 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 4/78 (5%) Frame = +3 Query: 60 ALTDEQKEN-LKKHRADCLSETKADEQLVNKLKTGDFKTE-NEPLKKYALCMLIKSQLMT 233 A+T +Q N + R C + K +E ++ L+ F ++ LK YA+C+ + MT Sbjct: 26 AMTMKQLTNSMDMMRQACAPKFKVEEAELHGLRKSIFPANPDKELKCYAMCIAQMAGTMT 85 Query: 234 KDGK--FKKTSLWLKCLM 281 K G+ F KT ++ ++ Sbjct: 86 KKGEISFSKTMAQIEAML 103 >AF437887-1|AAL84182.1| 150|Anopheles gambiae odorant binding protein protein. Length = 150 Score = 30.7 bits (66), Expect = 0.044 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 4/78 (5%) Frame = +3 Query: 60 ALTDEQKEN-LKKHRADCLSETKADEQLVNKLKTGDFKTE-NEPLKKYALCMLIKSQLMT 233 A+T +Q N + R C + K +E ++ L+ F ++ LK YA+C+ + MT Sbjct: 26 AMTMKQLTNSMDMMRQACAPKFKVEEAELHGLRKSIFPANPDKELKCYAMCIAQMAGTMT 85 Query: 234 KDGK--FKKTSLWLKCLM 281 K G+ F KT ++ ++ Sbjct: 86 KKGEISFSKTMAQIEAML 103 >AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding protein AgamOBP24 protein. Length = 176 Score = 28.3 bits (60), Expect = 0.24 Identities = 14/60 (23%), Positives = 27/60 (45%) Frame = +3 Query: 63 LTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDG 242 L E + ++ +C+ ET + ++ +GDF + K + C L K+ + DG Sbjct: 48 LEAEHVRRIHQNARECVKETGILPKNAFRVLSGDFSVDTMKAKCFVKCFLDKAGFIDDDG 107 >AY146722-1|AAO12082.1| 107|Anopheles gambiae odorant-binding protein AgamOBP16 protein. Length = 107 Score = 26.6 bits (56), Expect = 0.72 Identities = 11/51 (21%), Positives = 26/51 (50%) Frame = +3 Query: 57 QALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCM 209 ++L+ E + + + R++CL ET ++ + + + + L+ Y CM Sbjct: 22 KSLSPELLQQMGQFRSECLRETGTTDEQIEQFNSPQSVQASHELQCYMYCM 72 >AY146720-1|AAO12080.1| 147|Anopheles gambiae odorant-binding protein AgamOBP15 protein. Length = 147 Score = 26.6 bits (56), Expect = 0.72 Identities = 11/51 (21%), Positives = 26/51 (50%) Frame = +3 Query: 57 QALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCM 209 ++L+ E + + + R++CL ET ++ + + + + L+ Y CM Sbjct: 22 KSLSPELLQQMGQFRSECLRETGTTDEQIEQFNSPQSVQASHELQCYMYCM 72 >AF437885-1|AAL84180.1| 157|Anopheles gambiae odorant binding protein protein. Length = 157 Score = 25.4 bits (53), Expect = 1.7 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +3 Query: 108 CLSETKADEQLVNKLKTGDFKTENEPLKKYALCM 209 CL ET + V + D +N LK Y CM Sbjct: 57 CLEETGVSPEAVKRFSDADPFDDNRALKCYMDCM 90 Score = 24.2 bits (50), Expect = 3.8 Identities = 17/68 (25%), Positives = 28/68 (41%) Frame = +2 Query: 197 CSMYADQITADDQGREIQEDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWNYVKC 376 C +T DD+G E+ L VP + + + + C KG + + + KC Sbjct: 89 CMFRVTNVT-DDRG-ELHMGKLLEHVPTEFEDIALRMGV-RCTRPKGKDVCERAFWFHKC 145 Query: 377 YHEKDPKH 400 + DP H Sbjct: 146 WKTSDPVH 153 >AY146719-1|AAO12079.1| 159|Anopheles gambiae odorant-binding protein AgamOBP2 protein. Length = 159 Score = 25.0 bits (52), Expect = 2.2 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +3 Query: 108 CLSETKADEQLVNKLKTGDFKTENEPLKKYALCM 209 CL ET + + + D +N LK Y CM Sbjct: 57 CLEETGVSPEAIKRFSDADPFDDNRALKCYMDCM 90 >DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. Length = 93 Score = 24.2 bits (50), Expect = 3.8 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Frame = +3 Query: 12 IMKTFI----VFVVCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDF 167 IMK+FI + ++C + T + K AD +S V K KTG + Sbjct: 13 IMKSFIAAAVIALICAIAVSGTTVTLQSTCKLFTADVVSSITCKMYCVIKGKTGGY 68 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 24.2 bits (50), Expect = 3.8 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +1 Query: 364 LCEMLPRERPEARSFLVNT*SNPTVPYLISV 456 +CE+LPR +P S ++ +PT ++ +V Sbjct: 447 VCELLPRLQPRYHSISSSSKLHPTTVHVTAV 477 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 8 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 42 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 260 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTXWN 364 A+ ++ ++ K+EK+ D+ L S Q+ WN Sbjct: 23 AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWN 57 >EF588665-1|ABQ96851.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588664-1|ABQ96850.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588663-1|ABQ96849.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588662-1|ABQ96848.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588661-1|ABQ96847.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588660-1|ABQ96846.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588659-1|ABQ96845.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588658-1|ABQ96844.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588657-1|ABQ96843.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588656-1|ABQ96842.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588655-1|ABQ96841.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588654-1|ABQ96840.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588653-1|ABQ96839.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588651-1|ABQ96838.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588650-1|ABQ96837.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588649-1|ABQ96836.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588647-1|ABQ96835.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588646-1|ABQ96834.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588645-1|ABQ96833.1| 161|Anopheles gambiae transposase protein. Length = 161 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 116 KKFVYSLNPNYIMPTRKSLSNAL 138 >EF588642-1|ABQ96832.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588641-1|ABQ96831.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588640-1|ABQ96830.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588639-1|ABQ96829.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588638-1|ABQ96828.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588637-1|ABQ96827.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588636-1|ABQ96826.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588635-1|ABQ96825.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588634-1|ABQ96824.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588633-1|ABQ96823.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588632-1|ABQ96822.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588631-1|ABQ96821.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588630-1|ABQ96820.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588629-1|ABQ96819.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588628-1|ABQ96818.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588627-1|ABQ96817.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588626-1|ABQ96816.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588625-1|ABQ96815.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588624-1|ABQ96814.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588623-1|ABQ96813.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588622-1|ABQ96812.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588621-1|ABQ96811.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588620-1|ABQ96810.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588618-1|ABQ96809.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588617-1|ABQ96808.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588616-1|ABQ96807.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588615-1|ABQ96806.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588614-1|ABQ96805.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588613-1|ABQ96804.1| 161|Anopheles gambiae transposase protein. Length = 161 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 116 KKFVYSLNPNYIMPTRKSLSNAL 138 >EF588612-1|ABQ96803.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588611-1|ABQ96802.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588610-1|ABQ96801.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588609-1|ABQ96800.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588608-1|ABQ96799.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588607-1|ABQ96798.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588606-1|ABQ96797.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588605-1|ABQ96796.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588604-1|ABQ96795.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588603-1|ABQ96794.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588602-1|ABQ96793.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588601-1|ABQ96792.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588600-1|ABQ96791.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588599-1|ABQ96790.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588598-1|ABQ96789.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588597-1|ABQ96788.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588596-1|ABQ96787.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588595-1|ABQ96786.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588591-1|ABQ96785.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588590-1|ABQ96784.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588589-1|ABQ96783.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588588-1|ABQ96782.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588587-1|ABQ96781.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588586-1|ABQ96780.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588585-1|ABQ96779.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588584-1|ABQ96778.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588583-1|ABQ96777.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588582-1|ABQ96776.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588581-1|ABQ96775.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588580-1|ABQ96774.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588579-1|ABQ96773.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588577-1|ABQ96772.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588576-1|ABQ96771.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588574-1|ABQ96770.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588571-1|ABQ96769.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588570-1|ABQ96768.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588569-1|ABQ96767.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588568-1|ABQ96766.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588567-1|ABQ96765.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588566-1|ABQ96764.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588565-1|ABQ96763.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588564-1|ABQ96762.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588563-1|ABQ96761.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588562-1|ABQ96760.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588561-1|ABQ96759.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588560-1|ABQ96758.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588559-1|ABQ96757.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588558-1|ABQ96756.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588557-1|ABQ96755.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588556-1|ABQ96754.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588555-1|ABQ96753.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588554-1|ABQ96752.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588553-1|ABQ96751.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588551-1|ABQ63507.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588550-1|ABQ63506.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588549-1|ABQ63505.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588548-1|ABQ63504.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588547-1|ABQ63503.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588546-1|ABQ63502.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588545-1|ABQ63501.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588544-1|ABQ63500.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588543-1|ABQ63499.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588542-1|ABQ63498.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588541-1|ABQ63497.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588540-1|ABQ63496.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588539-1|ABQ63495.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588538-1|ABQ63494.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588537-1|ABQ63493.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588536-1|ABQ63492.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588535-1|ABQ63491.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588534-1|ABQ63490.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588533-1|ABQ63489.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588532-1|ABQ63488.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588531-1|ABQ63487.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588530-1|ABQ63486.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588529-1|ABQ63485.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588528-1|ABQ63484.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588527-1|ABQ63483.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588526-1|ABQ63482.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588525-1|ABQ63481.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588524-1|ABQ63480.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588523-1|ABQ63479.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588522-1|ABQ63478.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588521-1|ABQ63477.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588520-1|ABQ63476.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588519-1|ABQ63475.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588518-1|ABQ96750.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588517-1|ABQ96749.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588516-1|ABQ96748.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588515-1|ABQ96747.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588514-1|ABQ96746.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588512-1|ABQ96745.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588509-1|ABQ96744.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588508-1|ABQ96743.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588507-1|ABQ96742.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588506-1|ABQ96741.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588505-1|ABQ96740.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588504-1|ABQ96739.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588502-1|ABQ96737.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588501-1|ABQ96736.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588500-1|ABQ96735.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588499-1|ABQ96734.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588498-1|ABQ96733.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588497-1|ABQ96732.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588496-1|ABQ96731.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588494-1|ABQ96730.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588493-1|ABQ96729.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588492-1|ABQ96728.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588491-1|ABQ96727.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588490-1|ABQ96726.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588489-1|ABQ96725.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588488-1|ABQ96724.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588487-1|ABQ96723.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588486-1|ABQ96722.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588485-1|ABQ96721.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588484-1|ABQ96720.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588483-1|ABQ96719.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588482-1|ABQ96718.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588481-1|ABQ96717.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588480-1|ABQ96716.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588479-1|ABQ96715.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588478-1|ABQ96714.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588477-1|ABQ96713.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588476-1|ABQ96712.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588475-1|ABQ96711.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588474-1|ABQ96710.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588473-1|ABQ96709.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588472-1|ABQ96708.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588471-1|ABQ96707.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588470-1|ABQ96706.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588469-1|ABQ96705.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588467-1|ABQ96703.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588466-1|ABQ96702.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588465-1|ABQ96701.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588464-1|ABQ96700.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588463-1|ABQ96699.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588462-1|ABQ96698.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588461-1|ABQ96697.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 131 KKFVYTLNPNYIMPTRKSLSNAL 153 >EF588460-1|ABQ96696.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588459-1|ABQ96695.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588458-1|ABQ96694.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588457-1|ABQ96693.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588456-1|ABQ96692.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588455-1|ABQ96691.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588454-1|ABQ96690.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588453-1|ABQ96689.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588452-1|ABQ96688.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588451-1|ABQ96687.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588450-1|ABQ96686.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 >EF588449-1|ABQ96685.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 616 KKIKFXFSIXYVTPTKQNLSNXI 548 KK + + Y+ PT+++LSN + Sbjct: 132 KKFVYTLNPNYIMPTRKSLSNAL 154 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,866 Number of Sequences: 2352 Number of extensions: 12701 Number of successful extensions: 300 Number of sequences better than 10.0: 273 Number of HSP's better than 10.0 without gapping: 297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 299 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -