BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0892 (673 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26910.1 68415.m03228 ABC transporter family protein similar ... 29 2.8 At3g48185.1 68416.m05256 expressed protein 29 3.7 >At2g26910.1 68415.m03228 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza] Length = 1420 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +2 Query: 302 FKFSYVKFLPYLLICYFVV--FRFYSMCKCILT 394 F++S VKFL YL YF + F FY M +T Sbjct: 1270 FEWSAVKFLWYLFFMYFSIMYFTFYGMMTTAIT 1302 >At3g48185.1 68416.m05256 expressed protein Length = 85 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +2 Query: 257 IK*NILYIGFQFCV*FKFSYVKFLPYLLICYFVVFRFYSMC 379 IK Y F FCV F F Y + LL +F + F C Sbjct: 37 IKCVCFYSFFSFCVSFSFDYPLYFYLLLFFFFRISPFSDRC 77 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,131,406 Number of Sequences: 28952 Number of extensions: 183864 Number of successful extensions: 263 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 263 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -