BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0889 (673 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) 29 4.5 SB_38490| Best HMM Match : Neur_chan_LBD (HMM E-Value=2e-24) 28 7.9 >SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) Length = 2269 Score = 28.7 bits (61), Expect = 4.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 460 NYCKVCKTRHHFSDCYK 510 N C+ C RHH DC+K Sbjct: 373 NLCRKCLRRHHTDDCHK 389 >SB_38490| Best HMM Match : Neur_chan_LBD (HMM E-Value=2e-24) Length = 478 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -2 Query: 549 SYAKNYFYLILSMLIAVTKMVSCLTYLTIIL 457 S + +Y I++M+ + +++C+TYLT IL Sbjct: 198 SLVRRPYYYIMNMIFPCS-LIACMTYLTFIL 227 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,803,267 Number of Sequences: 59808 Number of extensions: 279183 Number of successful extensions: 422 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 422 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1721264831 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -