BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0886 (679 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4IXR2 Cluster: Hypothetical membrane protein; n=11; Fr... 35 2.1 UniRef50_Q8IBW3 Cluster: Putative uncharacterized protein MAL7P1... 35 2.1 UniRef50_A7R600 Cluster: Chromosome undetermined scaffold_1105, ... 33 4.8 UniRef50_Q04QF1 Cluster: Putative uncharacterized protein; n=2; ... 33 6.4 >UniRef50_A4IXR2 Cluster: Hypothetical membrane protein; n=11; Francisella tularensis|Rep: Hypothetical membrane protein - Francisella tularensis subsp. tularensis (strain WY96-3418) Length = 239 Score = 34.7 bits (76), Expect = 2.1 Identities = 23/63 (36%), Positives = 34/63 (53%) Frame = +3 Query: 276 FKSKYYKELVKFRVSLKKNTKAFCIITIFHSDMCKFFVTLNVSFSSASLKLSNISIISQE 455 F+SKY K++ +L KNT+ F I T S FV L++ S + +LSN+ +I Sbjct: 80 FQSKYIKDINSQLANLAKNTEPFYIETNGFSAGKSGFVMLDIKNSQSLQQLSNV-VIKDL 138 Query: 456 RKY 464 KY Sbjct: 139 AKY 141 >UniRef50_Q8IBW3 Cluster: Putative uncharacterized protein MAL7P1.64; n=5; Plasmodium|Rep: Putative uncharacterized protein MAL7P1.64 - Plasmodium falciparum (isolate 3D7) Length = 357 Score = 34.7 bits (76), Expect = 2.1 Identities = 22/85 (25%), Positives = 44/85 (51%), Gaps = 9/85 (10%) Frame = +3 Query: 135 ILCFHNT-CLQ*YLLYTICYVVYLIKLRPMNRVTI-IYVYQ----DPINNF*FFKSKY-- 290 I+C+++ L YL+Y +C++ +L +R N I IY + D + N+ ++ + Sbjct: 132 IICYYSLWILCYYLIYFLCFLSFLYGIRKFNNNVINIYTLRTCKIDKLTNYILSENTFIS 191 Query: 291 -YKELVKFRVSLKKNTKAFCIITIF 362 Y ++ F V + K T +F ++ F Sbjct: 192 LYWAIINFNVFMSKYTDSFYVVNYF 216 >UniRef50_A7R600 Cluster: Chromosome undetermined scaffold_1105, whole genome shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome undetermined scaffold_1105, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 319 Score = 33.5 bits (73), Expect = 4.8 Identities = 32/118 (27%), Positives = 52/118 (44%), Gaps = 9/118 (7%) Frame = +3 Query: 183 ICYVVYLIKLRPMNRVTIIYVYQDPINNF*FFKSKYYKELVKFRVSLKKNTKAFCIITIF 362 IC +Y LRP+ +V ++++ P + + KY + LK N+ A +T + Sbjct: 150 ICNDLYAPALRPLRQVAKVHIFVQPTVSRVVSRLKYICNM----EGLKTNSTALAALTEY 205 Query: 363 HSDMCKFFVTLN-VSFSSASLKLSNISIIS-------QERKYTNLST-FIFEYVFISH 509 +MC LN + F + + N+ IS Q RK +S F F Y IS+ Sbjct: 206 TGEMCDIRSCLNTLQFLNKKNQTLNVFEISSQVKEIFQNRKMNGMSNGFDFLYPLISN 263 >UniRef50_Q04QF1 Cluster: Putative uncharacterized protein; n=2; Leptospira borgpetersenii serovar Hardjo-bovis|Rep: Putative uncharacterized protein - Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) Length = 302 Score = 33.1 bits (72), Expect = 6.4 Identities = 21/59 (35%), Positives = 30/59 (50%) Frame = +3 Query: 72 NLIESNFHSKNMLDNIIVLVIILCFHNTCLQ*YLLYTICYVVYLIKLRPMNRVTIIYVY 248 NLIES+F KN+L I LV+I +C+ ++ + Y L P V IIY + Sbjct: 86 NLIESDFKQKNVL-FFIDLVVITYLFLSCISLNMIEMVDYQTSSYNLLPAYHVLIIYSF 143 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 575,033,324 Number of Sequences: 1657284 Number of extensions: 10620158 Number of successful extensions: 22328 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22324 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52479343733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -