Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--0886
         (679 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_01_0066 - 465526-466107,466541-466741                               28   7.9  

>05_01_0066 - 465526-466107,466541-466741
          Length = 260

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 2/67 (2%)
 Frame = -1

Query: 493 YSKINVDKLVYFRSCD--IIEILLNFKDAELKLTFNVTKNLHISE*KMVMIQNALVFFFK 320
           +SK  VD  +YF      I+   L  + +E++L FN  K       ++ ++ +A VF  K
Sbjct: 105 FSKGLVDMKIYFIESQPKIVSETLESRLSEVELVFNCVKKALEGTVEIKILSDAQVFHGK 164

Query: 319 LTRNFTN 299
           +T   TN
Sbjct: 165 ITACTTN 171


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,075,081
Number of Sequences: 37544
Number of extensions: 242307
Number of successful extensions: 386
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 379
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 386
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1726796312
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)