BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0885 (681 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 25 2.2 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 6.7 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 25.0 bits (52), Expect = 2.2 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -3 Query: 655 INTL-LRQFKLFYXSPSQQNCXLXKCFIVHYYWW*DLL 545 IN L L Q+K F P + L +C + +W D+L Sbjct: 51 INPLRLDQYKKFVYPPDRDTMCLIRCIGISLDFWDDIL 88 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 311 FFVLLSLTAHTVRSDSVSDCSKNIVYLTYK 222 FF +AH + + CS N LTY+ Sbjct: 34 FFSTRRSSAHCTQQTRQASCSDNAAQLTYR 63 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 649,561 Number of Sequences: 2352 Number of extensions: 13116 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -