BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0884 (678 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 22 4.7 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 8.2 AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 21 8.2 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 591 NGLSCKVAKMSLKPNTF 541 NG++C L PNTF Sbjct: 319 NGIACWDTNTELNPNTF 335 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = +1 Query: 388 NYIYIHIYSKMLNFPTFLLKNYIICISDVIAS 483 NY+ +H + LN P+ + C + I S Sbjct: 379 NYLTVHSFPSTLNIPSVKIDEDQKCSIESITS 410 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -3 Query: 457 LCNFSGETLENSTSYYIYVYICNSY 383 LC F +E S+S Y C+ Y Sbjct: 173 LCIFGNRLIEESSSVMEAAYSCHWY 197 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,298 Number of Sequences: 438 Number of extensions: 3290 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -