Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--0884
         (678 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g67320.1 68414.m07662 DNA primase, large subunit family conta...    28   4.9  

>At1g67320.1 68414.m07662 DNA primase, large subunit family contains
           Pfam profile PF04104: Eukaryotic-type DNA primase, large
           subunit; similar to DNA primase large subunit (EC
           2.7.7.-) (DNA primase 58 kDa subunit) (p58)
           (Swiss-Prot:P49643) [Homo sapiens]
          Length = 449

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +2

Query: 68  KETKNIFNKQQEINKKCIS---ISLVYCCS*RLEKLILSM 178
           KE   + N  + INK  IS   + LVYC S  L+K  LSM
Sbjct: 73  KEHMRLSNVSEMINKDIISHFVLRLVYCRSDELKKWFLSM 112


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,605,550
Number of Sequences: 28952
Number of extensions: 203589
Number of successful extensions: 302
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 298
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 302
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1428369392
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)