BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0877 (673 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22A12.09c |sap114||splicing factor Sap114|Schizosaccharomyce... 33 0.050 SPBP19A11.07c ||SPBP4H10.02c|human down-regulated in multiple ca... 25 7.5 SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycos... 25 7.5 SPCC1322.01 ||SPCC23B6.06|3'-5' exonuclease for RNA 3' ss-tail|S... 25 9.9 >SPAC22A12.09c |sap114||splicing factor Sap114|Schizosaccharomyces pombe|chr 1|||Manual Length = 481 Score = 32.7 bits (71), Expect = 0.050 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -3 Query: 671 SASFAYRNFXAFVSDYRQYQDANIRKA*LPPPNALHPYY 555 SAS+ RN AF RQ + AN + A L + HPYY Sbjct: 48 SASYVARNGPAFEEKIRQNEQANTKFAFLHANDPYHPYY 86 >SPBP19A11.07c ||SPBP4H10.02c|human down-regulated in multiple cancers-1 homolog 2|Schizosaccharomyces pombe|chr 2|||Manual Length = 676 Score = 25.4 bits (53), Expect = 7.5 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 370 IHEIRFSCNSSLIVSTPASDLYVLTLVSFV 459 I E+ FS +S IVS A D+Y+ + SFV Sbjct: 220 IDELDFSVLNS-IVSLDAKDIYIRVICSFV 248 >SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 25.4 bits (53), Expect = 7.5 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -1 Query: 658 HIXTXXHSSQITXNTKMPTFGKLNFLRQM 572 H+ H + I N + P FG N+L Q+ Sbjct: 295 HMRVEPHQTWIELNPRYPVFGGWNYLFQL 323 >SPCC1322.01 ||SPCC23B6.06|3'-5' exonuclease for RNA 3' ss-tail|Schizosaccharomyces pombe|chr 3|||Manual Length = 957 Score = 25.0 bits (52), Expect = 9.9 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -1 Query: 661 LHIXTXXHSSQITXNTKMPTFGKLNFLRQMHFTHIIYGLKL 539 LHI +S + + + TF + NF H I+Y L L Sbjct: 538 LHIHVANPTSTVDIRSPLGTFAERNFQTIYHPNKIVYMLPL 578 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,536,450 Number of Sequences: 5004 Number of extensions: 48197 Number of successful extensions: 94 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -