BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0877 (673 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 2.6 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 2.6 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 22 6.1 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 6.1 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 488 VSINQFVSIMPSLLYVS*FQPI 553 V N+F+SI+P LY QP+ Sbjct: 141 VLANEFLSILPIFLYALGEQPL 162 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 488 VSINQFVSIMPSLLYVS*FQPI 553 V N+F+SI+P LY QP+ Sbjct: 179 VLANEFLSILPIFLYALGEQPL 200 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.8 bits (44), Expect = 6.1 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -2 Query: 69 TPQPDTVRDTLAYIP 25 TP+PD + + L ++P Sbjct: 331 TPEPDCIHELLGHMP 345 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 6.1 Identities = 18/63 (28%), Positives = 26/63 (41%) Frame = -3 Query: 233 LKLMRSRKPTNIFLKKTIIFDSLVKENTYKLTSNQECY*NGSVLNY*NSRKVHPTLHNLT 54 LK + S PT + T D NT +L Q NG V+++ N H L Sbjct: 413 LKCVASGNPTP---EITWELDGKRLSNTERLQVGQYVTVNGDVVSHLNISSTHTNDGGLY 469 Query: 53 QCV 45 +C+ Sbjct: 470 KCI 472 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,590 Number of Sequences: 438 Number of extensions: 3562 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -