BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0869 (678 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5C5Q2 Cluster: SJCHGC05915 protein; n=1; Schistosoma j... 36 0.69 UniRef50_A7TEW6 Cluster: Putative uncharacterized protein; n=1; ... 33 4.8 >UniRef50_Q5C5Q2 Cluster: SJCHGC05915 protein; n=1; Schistosoma japonicum|Rep: SJCHGC05915 protein - Schistosoma japonicum (Blood fluke) Length = 344 Score = 36.3 bits (80), Expect = 0.69 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +3 Query: 153 NSSQSHSVQLNCLKGEEQSHXVHKLQSP*KPTENIKIHDHPSMQSF 290 ++S HS+ ++ L+ SH V+ SP P + +K++DHP++ F Sbjct: 87 STSALHSLDIDWLEAAAHSHSVNSSSSPVYPND-VKVYDHPTLNDF 131 >UniRef50_A7TEW6 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 513 Score = 33.5 bits (73), Expect = 4.8 Identities = 30/88 (34%), Positives = 46/88 (52%), Gaps = 2/88 (2%) Frame = +2 Query: 155 FISITFRSVELSQGRRTITLXP*TPVPMKTNRKHQNS*SSIYAI--FSKLSFDFLSFGRF 328 FI +++E+ G R T+ P TP ++ K+ NS SS+ + FS+ S S G Sbjct: 22 FIENGDKNLEMDTGTRATTV-PNTPT---SDTKNSNSHSSVSPLRSFSRRSGTGSSVGST 77 Query: 329 SFTTLLSMQLLFPFYLS**KHRINDMKS 412 + T LS QLL P L+ +H + D+ S Sbjct: 78 AGKTNLSPQLLTPVRLNEGEHPLKDIPS 105 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 563,634,173 Number of Sequences: 1657284 Number of extensions: 10057726 Number of successful extensions: 20975 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20967 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52479343733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -