BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0869 (678 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g28070.1 68415.m03408 ABC transporter family protein 29 2.1 At2g04620.1 68415.m00470 cation efflux family protein potential ... 28 6.5 >At2g28070.1 68415.m03408 ABC transporter family protein Length = 730 Score = 29.5 bits (63), Expect = 2.1 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +3 Query: 276 SMQSFLNYHLIFSLLEDFPSLLYFLCNFYSLFICLNKN 389 S+ S L ++ + L +DF L+YF+ NF F+CL N Sbjct: 551 SISSSLVFYFMVGLRDDFSLLMYFVLNF---FMCLLVN 585 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 27.9 bits (59), Expect = 6.5 Identities = 22/52 (42%), Positives = 25/52 (48%) Frame = +2 Query: 224 TPVPMKTNRKHQNS*SSIYAIFSKLSFDFLSFGRFSFTTLLSMQLLFPFYLS 379 TP P KT +S SI+ S LSF FL FS +L S L PF S Sbjct: 36 TPTPSKTRLSSSSSYRSIHGSKSSLSFLFLIL--FSLRSLYS---LLPFLRS 82 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,483,930 Number of Sequences: 28952 Number of extensions: 229499 Number of successful extensions: 414 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -