BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0867 (578 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC869.01 |||amidase |Schizosaccharomyces pombe|chr 1|||Manual 25 8.0 SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce... 25 8.0 >SPAC869.01 |||amidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 583 Score = 25.0 bits (52), Expect = 8.0 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +3 Query: 336 WHRLEHVRSWVNELDRLKASHLATPRTATGSVPNGNMTSSGTST*Y 473 W +E+VR + A + P+T + NG + SGTS Y Sbjct: 470 WQAVEYVRRTSQDEGIDYALNYTDPKTNDSFILNGLLVPSGTSITY 515 >SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 25.0 bits (52), Expect = 8.0 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 360 SWVNELDRLKASHLATPRTATGSVPNGNMTSSGTST 467 S N L S +TP + + VP TSSG +T Sbjct: 654 SGFNTTSGLPTSSASTPSSNSSIVPTSTFTSSGFNT 689 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,270,755 Number of Sequences: 5004 Number of extensions: 42876 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 248115846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -