BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0858 (617 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16903| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_55500| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=2.8e-24) 47 1e-05 SB_48160| Best HMM Match : Cytochrom_C (HMM E-Value=1.8e-05) 28 5.3 SB_57776| Best HMM Match : EB (HMM E-Value=2.9) 28 7.0 SB_46996| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_2776| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_16903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 76.6 bits (180), Expect = 2e-14 Identities = 40/92 (43%), Positives = 49/92 (53%) Frame = +3 Query: 255 LQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXXXXXXXXXXXXXXXXXXXXX 434 L +RLKVPP INQFTQ LD+ + LFK+L KYRPET Sbjct: 70 LYQRLKVPPAINQFTQALDRQSTVQLFKLLHKYRPETKAEKKARLSAKAEKKAEGKEEAP 129 Query: 435 XXRPNTIRSGTNTVTKLVEKKEXAAVVIAHDV 530 +P ++ G N +T LVE K+ VVIAHDV Sbjct: 130 GKKPMLVKYGINHITSLVENKKAQLVVIAHDV 161 Score = 72.5 bits (170), Expect = 2e-13 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +1 Query: 133 NPLFEKRPKNFAIGQGIQPTRDLSRFVRWPKYIRIQRQKAV 255 NPL EKRP+NF IG IQP RDLSRFVRWP+Y+++QRQK++ Sbjct: 29 NPLIEKRPRNFGIGGDIQPKRDLSRFVRWPRYVKLQRQKSL 69 >SB_55500| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=2.8e-24) Length = 172 Score = 46.8 bits (106), Expect = 1e-05 Identities = 25/67 (37%), Positives = 31/67 (46%) Frame = +3 Query: 330 LFKILEKYRPETXXXXXXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNTVTKLVEKKEXAA 509 LFK+L KYRPET +P ++ G N +T LVE K+ Sbjct: 4 LFKLLHKYRPETKAEKKARLSAKAEKKAEGKEEAPGKKPMLVKYGINHITSLVENKKAQL 63 Query: 510 VVIAHDV 530 VVIAHDV Sbjct: 64 VVIAHDV 70 >SB_48160| Best HMM Match : Cytochrom_C (HMM E-Value=1.8e-05) Length = 212 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 443 PLWWRLIFLGNLSFSSFPQPLFPG 372 P WW ++F+G + FS L+PG Sbjct: 56 PKWWFMLFIGTIVFSIGYLVLYPG 79 >SB_57776| Best HMM Match : EB (HMM E-Value=2.9) Length = 669 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 126 DRESSLREEAKELCYWSGH 182 DR ++ E KE+CYW GH Sbjct: 187 DRRKNMEERHKEMCYW-GH 204 >SB_46996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 126 DRESSLREEAKELCYWSGH 182 DR ++ E KE+CYW GH Sbjct: 137 DRRKNMEERHKEMCYW-GH 154 >SB_2776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1792 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 428 ASTKEAQHHPIRHKHSHQAGREERXRSCGHRS 523 A + +H +HKH H+ G+ + HRS Sbjct: 475 AKKESRKHKKHKHKHEHKEGQHKGSHRSSHRS 506 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,004,783 Number of Sequences: 59808 Number of extensions: 295274 Number of successful extensions: 730 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -