BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0851 (608 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3A11.09 |sod22||plasma membrane alkali metal cation/H+ antip... 27 2.8 SPBC1271.02 |stt3||oligosaccharyltransferase subunit Stt3|Schizo... 26 5.0 SPBC11C11.08 |srp1||SR family protein Srp1|Schizosaccharomyces p... 25 8.7 >SPAC3A11.09 |sod22||plasma membrane alkali metal cation/H+ antiporter Sod22|Schizosaccharomyces pombe|chr 1|||Manual Length = 759 Score = 26.6 bits (56), Expect = 2.8 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +3 Query: 378 ASTKRRKTSTGIFQGSSSDVTPLPEGAAPETVESRLSSXRGSHHTA 515 AS+ RR+ I + +D++ + A E R S RG H+ A Sbjct: 484 ASSIRRRHPVNIQEDEDADISTVSLPEAAHLREERAESPRGGHYDA 529 >SPBC1271.02 |stt3||oligosaccharyltransferase subunit Stt3|Schizosaccharomyces pombe|chr 2|||Manual Length = 752 Score = 25.8 bits (54), Expect = 5.0 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 64 YNQICLFYHSCWVTGPAFVTTTGPVVLLIKILD 162 Y I YHS WVT A+ + P V+L +L+ Sbjct: 491 YFLIMFVYHSSWVTSNAY---SSPTVVLSTVLN 520 >SPBC11C11.08 |srp1||SR family protein Srp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 275 Score = 25.0 bits (52), Expect = 8.7 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +2 Query: 509 YRAXEGTPDGPSRGRSRKRLAPXXTXNPGSPV 604 YR+ +PDG SR R +P SPV Sbjct: 143 YRSRSRSPDGRSRSPDYDRRSPKRNHRSPSPV 174 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,352,244 Number of Sequences: 5004 Number of extensions: 45098 Number of successful extensions: 131 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 131 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 268287866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -