BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0851 (608 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 62 2e-11 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 4.4 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 5.8 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 61.7 bits (143), Expect = 2e-11 Identities = 29/57 (50%), Positives = 35/57 (61%) Frame = +2 Query: 260 DLGSSIKADKDKFQVNLDVQHFSPEEISVKTADGYIVVXXXXXXXXXXXXYISRQFV 430 D GS++ KDKFQ+NLDVQ FSPEEISVK D ++V Y+SR FV Sbjct: 3 DSGSAVNISKDKFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFV 59 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = +2 Query: 506 PYRAXEGTPDGPSRGRSRKRLAPXXTXNPGSP 601 P R G P GP R + P T P P Sbjct: 178 PARPNPGMPPGPQMMRPPGNVGPPRTGTPTQP 209 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.4 bits (48), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 202 QATAASMSFGVSANPKS*STRRLGQWL*RTRG 107 ++ A S G A PK+ + +G W TRG Sbjct: 139 RSMAGFRSLGSGAPPKAQGGKHVGNWEQHTRG 170 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 618,660 Number of Sequences: 2352 Number of extensions: 12540 Number of successful extensions: 76 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -