BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0848 (418 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 21 4.8 AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 20 8.4 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 20 8.4 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 21.0 bits (42), Expect = 4.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 217 LAATPE*GRKPL*XLXKRCSCYYGMSQLXKS 309 L P+ +KPL + SCY ++L +S Sbjct: 214 LLRLPKFKKKPLLCVVSTLSCYLERTELLRS 244 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 20.2 bits (40), Expect = 8.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 112 FYRISEXCRFIYLKCL 159 FYR + +FI++K + Sbjct: 51 FYRAKDYAKFIHIKAV 66 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 20.2 bits (40), Expect = 8.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 112 FYRISEXCRFIYLKCL 159 FYR + +FI++K + Sbjct: 51 FYRAKDYAKFIHIKAV 66 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,472 Number of Sequences: 336 Number of extensions: 1235 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9174063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -