BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0847 (598 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4Y3H6 Cluster: Putative uncharacterized protein; n=4; ... 35 1.3 UniRef50_UPI00006CB83F Cluster: hypothetical protein TTHERM_0058... 33 3.9 UniRef50_UPI000049A4C7 Cluster: hypothetical protein 2.t00097; n... 32 8.9 UniRef50_A0DPI6 Cluster: Chromosome undetermined scaffold_59, wh... 32 8.9 >UniRef50_Q4Y3H6 Cluster: Putative uncharacterized protein; n=4; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 791 Score = 35.1 bits (77), Expect = 1.3 Identities = 19/49 (38%), Positives = 29/49 (59%) Frame = +1 Query: 73 ELQNINRNIQLNRSFNSIDVHTIIINKEGIERKLSLNL*LIITKCT*IK 219 EL N+NR +++N +F+ I H + KEG+ LS ++ I KC IK Sbjct: 564 ELNNLNRFLKINYNFSKIP-HIYLNKKEGVINPLSTDVIAINLKCNIIK 611 >UniRef50_UPI00006CB83F Cluster: hypothetical protein TTHERM_00580430; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00580430 - Tetrahymena thermophila SB210 Length = 922 Score = 33.5 bits (73), Expect = 3.9 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +1 Query: 82 NINRNIQLNRSFNSIDVHTIIINKE 156 NIN+ I LNRSFN++D + I++ K+ Sbjct: 753 NINQGINLNRSFNTVDNNQILMQKQ 777 >UniRef50_UPI000049A4C7 Cluster: hypothetical protein 2.t00097; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 2.t00097 - Entamoeba histolytica HM-1:IMSS Length = 702 Score = 32.3 bits (70), Expect = 8.9 Identities = 19/45 (42%), Positives = 26/45 (57%) Frame = +2 Query: 449 LYNQIVCSTFKTDICRKKTLFLRNGFILK*FSPNGKLDSFFSYFE 583 L I C TFK D K+T+ N F+LK F P ++D+FF F+ Sbjct: 299 LDKNIACKTFKED--GKQTI---NIFVLKTFYPETEVDNFFETFD 338 >UniRef50_A0DPI6 Cluster: Chromosome undetermined scaffold_59, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_59, whole genome shotgun sequence - Paramecium tetraurelia Length = 386 Score = 32.3 bits (70), Expect = 8.9 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = +3 Query: 390 C*HSGSCISGFSRGTIAY--SDCIIKSYVLPSRLIFAEKKRCFYATDSF*SNSARMESWI 563 C ++G CI+GF ++Y SDC I+ + ++L K+ F+ SF N ++ E + Sbjct: 97 CQNNGKCINGFCECPVSYLGSDCTIQIKDIENQLDLEPKQYYFFHIKSF--NISKFERQL 154 Query: 564 VSF 572 +F Sbjct: 155 ETF 157 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 527,845,346 Number of Sequences: 1657284 Number of extensions: 10037831 Number of successful extensions: 19785 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19775 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41902926763 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -