BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0847 (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 30 0.013 DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 21 7.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.9 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 30.3 bits (65), Expect = 0.013 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 88 NRNIQLNRSFNSIDVHTIIINKEGIERKLSLNL*LIIT 201 NRNI N S + + HT+ I+K+ + R L L + T Sbjct: 98 NRNIATNESADPLAFHTLFISKDAVWRNLRTKLSPVFT 135 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 21.0 bits (42), Expect = 7.9 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +1 Query: 58 FVNSTELQNINRNIQLNRSFNSIDVHTIIINK 153 FVN L R+ + ++++DV I+ +K Sbjct: 19 FVNGKTLHRSTRDDKYTTRYDNVDVDRILHSK 50 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = -3 Query: 167 LSIPSLFIIIVCTSI 123 LSIPS++++++ SI Sbjct: 1037 LSIPSMYLLLILYSI 1051 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = -3 Query: 167 LSIPSLFIIIVCTSI 123 LSIPS++++++ SI Sbjct: 1037 LSIPSMYLLLILYSI 1051 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = -3 Query: 167 LSIPSLFIIIVCTSI 123 LSIPS++++++ SI Sbjct: 1037 LSIPSMYLLLILYSI 1051 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = -3 Query: 167 LSIPSLFIIIVCTSI 123 LSIPS++++++ SI Sbjct: 1037 LSIPSMYLLLILYSI 1051 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,809 Number of Sequences: 336 Number of extensions: 2883 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -