BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0847 (598 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006662-5|AAF39894.1| 501|Caenorhabditis elegans Hypothetical ... 29 2.5 Z68011-3|CAA92014.2| 821|Caenorhabditis elegans Hypothetical pr... 27 7.7 >AC006662-5|AAF39894.1| 501|Caenorhabditis elegans Hypothetical protein H23L24.2 protein. Length = 501 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +1 Query: 61 VNSTELQNINRNIQ-LNRSFNSIDVHTIIINKEGIERKLSLN 183 + T+ NI R++Q ++ S +S+D H + NK IE+K++ N Sbjct: 94 IEMTDDANIKRDLQSISTSRSSVDSHHMAYNKLLIEKKINEN 135 >Z68011-3|CAA92014.2| 821|Caenorhabditis elegans Hypothetical protein T21B6.3 protein. Length = 821 Score = 27.5 bits (58), Expect = 7.7 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = -2 Query: 369 IDSFPNHSWLQIVHLHFNRSFHSSFIHSFTNLAASFDLYTRVIQTQEDIVFYLSALCD 196 +D FP S + +LH H ++ S ++ DL + + ++DIV L + D Sbjct: 67 VDIFPECSAVVYYYLHNETKKHFCYLFSDNSVQDKIDLVEQKPENKKDIVRMLELVVD 124 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,670,250 Number of Sequences: 27780 Number of extensions: 259333 Number of successful extensions: 485 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -