BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0836 (597 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5L184 Cluster: Putative uncharacterized protein GK1011... 32 8.9 >UniRef50_Q5L184 Cluster: Putative uncharacterized protein GK1011; n=1; Geobacillus kaustophilus|Rep: Putative uncharacterized protein GK1011 - Geobacillus kaustophilus Length = 123 Score = 32.3 bits (70), Expect = 8.9 Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 2/34 (5%) Frame = -2 Query: 179 RTLSINKE--FEIMIQDSLLTNYTSDSQPFFCCA 84 RTL+ +K+ F ++ Q++ LTN TSD PFF A Sbjct: 86 RTLTRSKQRIFYLVFQNNFLTNTTSDGNPFFTIA 119 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 381,216,444 Number of Sequences: 1657284 Number of extensions: 5818651 Number of successful extensions: 9449 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 9223 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9449 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41902926763 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -