BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0834 (481 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12207| Best HMM Match : Cytochrom_B_N (HMM E-Value=2.3e-07) 46 1e-05 SB_27597| Best HMM Match : Cytochrom_B_N (HMM E-Value=0) 32 0.21 >SB_12207| Best HMM Match : Cytochrom_B_N (HMM E-Value=2.3e-07) Length = 102 Score = 46.4 bits (105), Expect = 1e-05 Identities = 21/44 (47%), Positives = 32/44 (72%) Frame = +1 Query: 142 IYYTANIEIAFYRVNYICRNVNYG*IIRTLHANGASXFLFAFIY 273 ++Y A++ +AF V++I R+VNYG ++R HANGAS F F +Y Sbjct: 1 MHYCADVSLAFASVDHIMRDVNYGFLLRYAHANGASMF-FICLY 43 Score = 35.9 bits (79), Expect = 0.017 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 255 FICIYLHIGRGIYYESFNLKYV*SNWNYNSI 347 FIC+Y HIGRG+YY S++ V WN I Sbjct: 39 FICLYAHIGRGLYYGSYSKVEV---WNVGVI 66 >SB_27597| Best HMM Match : Cytochrom_B_N (HMM E-Value=0) Length = 135 Score = 32.3 bits (70), Expect = 0.21 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 376 YVLP*GQISFWGATVITNLLSAIPYLGTILV 468 Y LP QI +W ++T + AIP +G+ LV Sbjct: 64 YSLPRDQIGYWAVKIVTGVPEAIPVIGSPLV 94 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,777,419 Number of Sequences: 59808 Number of extensions: 179476 Number of successful extensions: 314 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 314 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1001731762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -