BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0834 (481 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07727.1 68415.m00977 cytochrome b (MTCYB) (COB) (CYTB) conta... 92 2e-19 At1g12170.1 68414.m01409 F-box family protein contains F-box dom... 31 0.30 At5g41680.2 68418.m05065 protein kinase family protein contains ... 29 1.6 At5g41680.1 68418.m05064 protein kinase family protein contains ... 29 1.6 >At2g07727.1 68415.m00977 cytochrome b (MTCYB) (COB) (CYTB) contains Pfam profile PF00033: Cytochrome b(N-terminal)/b6/petB; ontains Pfam profile PF00032: Cytochrome b(C-terminal)/b6/petD; 99% identical to apocytochrome B (GI:6851014), cytochrome b (GI:402962), and Cytochrome b (Swiss-Prot:P42792) [Arabidopsis thaliana] Length = 393 Score = 92.3 bits (219), Expect = 2e-19 Identities = 50/124 (40%), Positives = 75/124 (60%), Gaps = 2/124 (1%) Frame = +1 Query: 103 CLIIQIITGLFLTIYYTANIEIAFYRVNYICRNVNYG*IIRTLHANGASXFLF-AFIYIS 279 CL+IQI+TG+FL ++YT ++++AF V +I R+V G ++R +HANGAS FL +++I Sbjct: 45 CLVIQIVTGVFLAMHYTPHVDLAFNSVEHIMRDVEGGWLLRYMHANGASMFLIVVYLHIF 104 Query: 280 DEEFTMNLLT*NMYD-LXXXXXXXXXXXXXXXXYVLP*GQISFWGATVITNLLSAIPYLG 456 + + + + YVLP GQ+SFWGATVIT+L SAIP +G Sbjct: 105 RGLYHASYSSPREFVWCLGVVIFLLMIVTAFIGYVLPWGQMSFWGATVITSLASAIPVVG 164 Query: 457 TILV 468 +V Sbjct: 165 DTIV 168 >At1g12170.1 68414.m01409 F-box family protein contains F-box domain Pfam:PF00646 Length = 364 Score = 31.5 bits (68), Expect = 0.30 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +3 Query: 90 PTSXMSNNSNYYWIIFNNILHSKY*NSFL*SK-LYLPKCKL-WLNNS 224 P S +S N N YW++ N H + SF SK +Y C L W NS Sbjct: 196 PLSDVSLNGNLYWVVSNGETHECFIESFDFSKEIYKCFCTLPWNYNS 242 >At5g41680.2 68418.m05065 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to receptor-like protein kinase (GI:4008006) [Arabidopsis thaliana]; similar to receptor-like kinase RHG1 (GI:21239380) (GI:21239382) [Glycine max] Length = 333 Score = 29.1 bits (62), Expect = 1.6 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +3 Query: 222 SNITC*WSFIXFICIYLHIGRGIYYESFNLKYV*SNWNYNSIYTNSNCFHRLC 380 S + W I I G I +E+ + K+V N ++I+TNS C+ +C Sbjct: 147 SQVPLDWESRLRIAIGAARGLAIIHEADDGKFVHGNIKSSNIFTNSKCYGCIC 199 >At5g41680.1 68418.m05064 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to receptor-like protein kinase (GI:4008006) [Arabidopsis thaliana]; similar to receptor-like kinase RHG1 (GI:21239380) (GI:21239382) [Glycine max] Length = 359 Score = 29.1 bits (62), Expect = 1.6 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +3 Query: 222 SNITC*WSFIXFICIYLHIGRGIYYESFNLKYV*SNWNYNSIYTNSNCFHRLC 380 S + W I I G I +E+ + K+V N ++I+TNS C+ +C Sbjct: 173 SQVPLDWESRLRIAIGAARGLAIIHEADDGKFVHGNIKSSNIFTNSKCYGCIC 225 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,777,431 Number of Sequences: 28952 Number of extensions: 128756 Number of successful extensions: 216 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 216 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 819227264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -