BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0833 (594 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 2.6 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 22 3.4 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 4.5 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 5.9 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 22.6 bits (46), Expect = 2.6 Identities = 7/32 (21%), Positives = 19/32 (59%) Frame = -3 Query: 466 RYIYLTFKVFLCIKDSLSAPIIIVENTIMTVF 371 +YI ++C+ +++ P++I+ N M ++ Sbjct: 127 QYINYETDYYVCLAMTITGPLVIIGNIAMELW 158 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 22.2 bits (45), Expect = 3.4 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +1 Query: 454 GRYNELHNIPNVFFALHAXDNYLFKRNCCVYYSLFNLCRAMVY 582 G +NEL N+ V +++ N+LF S F++C Y Sbjct: 216 GVHNELCNLCQVANSIYGFQNFLF------VLSTFSICITQFY 252 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 544 YYSLFNLCRAMVY 582 YY++ CR MVY Sbjct: 329 YYNILYFCRIMVY 341 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.4 bits (43), Expect = 5.9 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = +3 Query: 6 RGAERPKMLHHHQYLTALRTGSNDSPN 86 RG+ P+ H+ L+ +ND+ N Sbjct: 99 RGSSTPESPEHYYNQKTLQANNNDASN 125 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,089 Number of Sequences: 336 Number of extensions: 3158 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -