BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0826 (337 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0665 - 18506221-18506271,18506331-18506401,18507097-185071... 31 0.18 05_01_0041 + 281427-281549,281671-281730,281822-281868,282013-28... 31 0.23 10_08_0080 - 14707309-14707420,14707799-14707846,14708418-147085... 29 0.93 03_06_0034 + 31197846-31198417,31198562-31198987,31199074-311993... 29 0.93 12_02_1275 - 27482784-27483272 28 1.6 06_03_0685 - 23499779-23500204 28 1.6 05_05_0230 - 23476919-23477372,23477656-23477695,23478578-234787... 28 1.6 04_04_0592 + 26477974-26479311 28 1.6 09_04_0361 - 16948740-16948860,16948951-16949018,16949424-169495... 28 2.2 02_01_0163 + 1135592-1135623,1135718-1135816,1135904-1135960,113... 28 2.2 09_06_0310 - 22212348-22212695,22213561-22213766,22213796-222139... 27 2.9 09_06_0293 + 22086359-22086496,22086604-22087213,22087407-220879... 27 2.9 09_02_0369 - 8012470-8013120 27 2.9 01_06_0997 + 33676441-33676758,33678223-33678314,33678443-336785... 27 2.9 01_01_1024 + 8083372-8083758,8083970-8084149,8084261-8084590,808... 27 2.9 05_06_0189 + 26257587-26257791,26257962-26258003,26258064-262584... 27 3.8 05_03_0408 + 13601576-13601748,13601795-13602104,13602597-136028... 27 3.8 05_03_0397 + 13488642-13488941,13489711-13489963,13490594-134906... 27 3.8 02_01_0660 - 4913033-4913368 27 3.8 01_06_1425 - 37273311-37273697 27 3.8 11_04_0460 - 17955102-17955146,17955253-17955310,17955442-179555... 27 5.0 10_08_1037 - 22477358-22478752 27 5.0 09_04_0507 + 18194320-18195081 27 5.0 08_01_0619 + 5412058-5413224,5413357-5413476,5413755-5413831,541... 27 5.0 05_04_0347 + 20479682-20479753,20480136-20480813,20481143-204821... 27 5.0 04_01_0617 - 8076624-8076971,8077761-8077883,8077965-8078035,807... 27 5.0 03_04_0163 + 17865529-17865801,17866030-17866102,17866251-17866270 27 5.0 02_05_1113 + 34207997-34208380 27 5.0 01_01_1081 + 8504035-8504461,8504546-8504685 27 5.0 12_02_1054 - 25721220-25721582,25723163-25723727,25724162-257244... 26 6.6 12_02_0118 - 13869237-13869307,13869375-13869465,13870321-138704... 26 6.6 09_04_0032 - 13953323-13955269 26 6.6 08_01_0489 + 4280063-4280476 26 6.6 08_01_0488 + 4277482-4277988 26 6.6 07_03_1495 + 26983415-26984797 26 6.6 06_03_0786 - 24579722-24580137,24580518-24580590 26 6.6 05_07_0146 + 28018236-28018580,28018670-28018777,28018984-280191... 26 6.6 05_06_0186 - 26207298-26208548,26208743-26208853,26209286-262095... 26 6.6 04_03_0073 - 10702352-10702619,10702702-10702836,10702915-10703594 26 6.6 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 26 6.6 03_02_1029 - 13488535-13493037 26 6.6 02_05_1293 - 35520733-35520963,35521696-35521878,35522040-355222... 26 6.6 02_04_0179 + 20682852-20684510,20684593-20684661,20684741-206848... 26 6.6 01_06_0499 + 29823578-29823754,29823882-29824002,29825103-298252... 26 6.6 12_02_0442 - 19118536-19119222 26 8.7 10_08_0929 + 21633179-21633377,21633466-21633809,21633905-21634297 26 8.7 08_02_0833 - 21623721-21623821,21624076-21624667 26 8.7 08_01_0133 + 1062365-1063057,1063210-1063318,1063914-1064005,106... 26 8.7 05_03_0446 + 14111667-14111906,14112011-14112418 26 8.7 04_04_0318 + 24347364-24348826,24348920-24349048,24349158-243492... 26 8.7 04_03_1004 + 21637910-21638269,21638424-21638579,21640108-216402... 26 8.7 01_06_0691 - 31268729-31269010,31269596-31270051,31270560-31271735 26 8.7 01_06_0146 + 26969011-26969995,26970878-26970930 26 8.7 01_04_0116 + 16189250-16189411,16189577-16190104 26 8.7 >04_03_0665 - 18506221-18506271,18506331-18506401,18507097-18507169, 18507476-18507805 Length = 174 Score = 31.5 bits (68), Expect = 0.18 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 131 WKWCGLRRDQTGREG 175 W WCGLRR + GR G Sbjct: 65 WMWCGLRRSKAGRRG 79 >05_01_0041 + 281427-281549,281671-281730,281822-281868,282013-282089, 285368-285440,286193-286281,286665-286711,286805-286885, 287011-287179,287381-287600,287679-287744,288194-288310, 288591-288628,288935-289032 Length = 434 Score = 31.1 bits (67), Expect = 0.23 Identities = 22/66 (33%), Positives = 27/66 (40%), Gaps = 4/66 (6%) Frame = -2 Query: 333 RSPLRAVQSREQGHQDHHRGPAPRH--SGNTRRPKPTELSACCRERSETPRHR--NKPSR 166 RSP R++G R P PR + R P R RS +P HR PSR Sbjct: 325 RSPRHLSPRRDRGSPIRRRSPLPRRRLTPPRRMWSPPRRPQSLRHRSRSPIHRPIRSPSR 384 Query: 165 PVWSRR 148 + RR Sbjct: 385 SISPRR 390 Score = 30.3 bits (65), Expect = 0.40 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 5/64 (7%) Frame = -2 Query: 330 SPLR--AVQSREQGHQDHHRGPAP--RHSGNTRRPKPT-ELSACCRERSETPRHRNKPSR 166 SP+R SR G R P+P R + R P + + R RS PR R P R Sbjct: 296 SPIRHGGTPSRRPGSPIRRRSPSPPPRRLRSPRHLSPRRDRGSPIRRRSPLPRRRLTPPR 355 Query: 165 PVWS 154 +WS Sbjct: 356 RMWS 359 >10_08_0080 - 14707309-14707420,14707799-14707846,14708418-14708543, 14708586-14708743 Length = 147 Score = 29.1 bits (62), Expect = 0.93 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -1 Query: 301 AGTSGPPQRPGAQAQRKHSASEADRAERLLPGALRDAPSPE 179 A T+GPPQ A ++R S S R+ PG SPE Sbjct: 40 ASTAGPPQSLRASSRRGGSPSLTRRSSPEKPGPFSQTRSPE 80 >03_06_0034 + 31197846-31198417,31198562-31198987,31199074-31199386, 31199510-31199560 Length = 453 Score = 29.1 bits (62), Expect = 0.93 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 226 AERLLPGALRDAPSPE*TFSTCLVSTESTPF 134 ++RL+ ALR PSP F++ L +TPF Sbjct: 39 SQRLVYAALRSLPSPRALFASLLSQLSATPF 69 >12_02_1275 - 27482784-27483272 Length = 162 Score = 28.3 bits (60), Expect = 1.6 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 128 QWKWCGLRRDQTGREG 175 +W W GLRR +TGR G Sbjct: 144 RWVWRGLRRTKTGRRG 159 >06_03_0685 - 23499779-23500204 Length = 141 Score = 28.3 bits (60), Expect = 1.6 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 148 PSRPNRSRRFIPVTGRL*ALPAASAQLCRLRTPSVSAVPG 267 P R R RR+ P GR+ LP ++CR R P + G Sbjct: 42 PPRGGRIRRWPPRRGRIRGLPPLGGRICR-RPPRGGRIHG 80 >05_05_0230 - 23476919-23477372,23477656-23477695,23478578-23478700, 23479114-23479151,23479289-23479674,23479875-23481053, 23481805-23481928,23482733-23482779 Length = 796 Score = 28.3 bits (60), Expect = 1.6 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -2 Query: 270 APRHSGNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRRS 145 AP+ S RP P S + R TP + +PS PV +R++ Sbjct: 122 APKQSIAASRPVPARSSTPVKTRPSTPT-KTRPSTPVRTRQT 162 >04_04_0592 + 26477974-26479311 Length = 445 Score = 28.3 bits (60), Expect = 1.6 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = -1 Query: 337 PPVTPPGGAEP*AGTSGPPQRPGAQAQRKHSASEADRAERLLPGALRDAP 188 PP TP P PP P A + + + A R + LL LR+ P Sbjct: 87 PPPTPTTTTTPTPTPPLPPPAPPASPAKSNKKASAKRNKSLLKLLLRETP 136 >09_04_0361 - 16948740-16948860,16948951-16949018,16949424-16949510, 16949626-16949694,16949786-16949854,16949944-16950765 Length = 411 Score = 27.9 bits (59), Expect = 2.2 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = -2 Query: 327 PLRAVQSREQGHQDHHR-----GPAPRHSGNTRRPKPTELSA 217 P + S +GH +HHR G R +G RPK LSA Sbjct: 44 PFCMLTSSSRGHAEHHRNGGGGGEHRREAGEGDRPKALPLSA 85 >02_01_0163 + 1135592-1135623,1135718-1135816,1135904-1135960, 1136053-1136116,1136174-1136392,1138562-1138945 Length = 284 Score = 27.9 bits (59), Expect = 2.2 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -1 Query: 334 PVTPPGGAEP*AGTSGPPQRPGAQAQRKHSASEADRA 224 PV PPG A P A P + GA+A S +EA +A Sbjct: 207 PVAPPGAAVPPAQPQPQPPQAGAEAVTTES-TEATQA 242 >09_06_0310 - 22212348-22212695,22213561-22213766,22213796-22213905, 22214351-22214427,22214466-22214486,22214518-22215651 Length = 631 Score = 27.5 bits (58), Expect = 2.9 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = -1 Query: 337 PPVTPPG--GAEP*AGTSGPPQRPGAQAQRKHS-ASEADRAERL 215 PP PP ++ S P +P AQAQR H A+E + RL Sbjct: 19 PPPPPPSTSSSQKSPSPSQPQPQPHAQAQRLHDLAAELEEERRL 62 >09_06_0293 + 22086359-22086496,22086604-22087213,22087407-22087938, 22088617-22089151 Length = 604 Score = 27.5 bits (58), Expect = 2.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 128 QWKWCGLRRDQTGREG 175 +W W GLRR +TGR G Sbjct: 558 RWVWRGLRRIKTGRRG 573 >09_02_0369 - 8012470-8013120 Length = 216 Score = 27.5 bits (58), Expect = 2.9 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 6/55 (10%) Frame = -2 Query: 333 RSPLRAVQSREQGHQD---HHRGPAPRHSGNTRRPKPTELS---ACCRERSETPR 187 R P S +G D HH P PR S R P E CC + PR Sbjct: 90 RRPAATPYSNREGVDDDDSHHVAPPPRRSPAARPPSAPETPLPLPCCEKPPPPPR 144 >01_06_0997 + 33676441-33676758,33678223-33678314,33678443-33678540, 33678824-33678979,33679106-33679731,33679826-33679896, 33679987-33680241,33680337-33680454,33680595-33680766, 33680854-33681395 Length = 815 Score = 27.5 bits (58), Expect = 2.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 128 QWKWCGLRRDQTGREG 175 +W+W GLRR + GR G Sbjct: 64 RWEWHGLRRTKAGRRG 79 >01_01_1024 + 8083372-8083758,8083970-8084149,8084261-8084590, 8084679-8084792,8084942-8085682 Length = 583 Score = 27.5 bits (58), Expect = 2.9 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 1/63 (1%) Frame = +3 Query: 129 NGNGVDSVETKQVEKVYSGDGASLSAPGSKRSALSAS-DAECFRCAWAPGLCGGPDVPAH 305 +G G ++ E +G S+ G+K S DA AW PG P + A Sbjct: 209 SGAGGEAAEEPSNSSTEAGSPRRSSSTGNKDQERGDSPDAPSTAAAWLPGRAMAPQMGAA 268 Query: 306 GSA 314 G+A Sbjct: 269 GAA 271 >05_06_0189 + 26257587-26257791,26257962-26258003,26258064-26258436, 26258515-26258656,26259356-26259514,26259599-26259661, 26259992-26260180 Length = 390 Score = 27.1 bits (57), Expect = 3.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 Query: 303 EQGHQDHHRGPAPRHSGNTRR 241 E+G QD RGP P G RR Sbjct: 140 EEGAQDRERGPRPPFQGGGRR 160 >05_03_0408 + 13601576-13601748,13601795-13602104,13602597-13602834, 13603014-13603364,13603457-13603542,13603685-13603759, 13604241-13604542,13605359-13605622,13606032-13606806 Length = 857 Score = 27.1 bits (57), Expect = 3.8 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 Query: 142 WTPSRPNRSRRFIPVTG 192 + P+RP R RRF+P+ G Sbjct: 716 YPPNRPTRCRRFVPLPG 732 >05_03_0397 + 13488642-13488941,13489711-13489963,13490594-13490673, 13491251-13491393,13491512-13491610,13491785-13491974, 13492504-13492902,13492993-13493400 Length = 623 Score = 27.1 bits (57), Expect = 3.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 337 PPVTPPGGAEP*AGTSGPPQRPGAQ 263 P P GA+ AG++GP ++PG + Sbjct: 586 PGAGPTPGADAAAGSAGPSEKPGGE 610 >02_01_0660 - 4913033-4913368 Length = 111 Score = 27.1 bits (57), Expect = 3.8 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = -2 Query: 318 AVQSREQGHQDHHRGPAPRHSGNTRRPKPTELSACCRERSETPRHRNK 175 AV+S GH H A P P++ C + +T RH ++ Sbjct: 20 AVRSARAGHASGHAAAADEEDAAAAAPAPSKGHGCNPLKDKTCRHDDR 67 >01_06_1425 - 37273311-37273697 Length = 128 Score = 27.1 bits (57), Expect = 3.8 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +2 Query: 125 LQWKWCGLRRDQTGREGL-FR*RGVSERSRQQALSS 229 L W+WC LRR + GL R R ++ QA S+ Sbjct: 73 LTWRWCKLRRTEDRVRGLQARLRQLAAAEESQAAST 108 >11_04_0460 - 17955102-17955146,17955253-17955310,17955442-17955593, 17955888-17955993,17956101-17956222,17956766-17956834, 17956969-17957214,17957331-17957373,17957449-17957520, 17957954-17958066,17958158-17958238,17958343-17958415, 17959413-17959519,17960410-17960514,17960684-17960974, 17961621-17961707,17961774-17961842,17961917-17961973, 17962057-17962155,17962223-17962312,17962395-17962511, 17964164-17964244,17964353-17964502,17964812-17964956, 17967359-17967510,17967647-17967784,17967838-17967914, 17968032-17968134 Length = 1015 Score = 26.6 bits (56), Expect = 5.0 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 105 SSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPGSKRSALSASDAE 248 SSS S+Y N +G +T +++ SG +S S +S+ D E Sbjct: 781 SSSSSRYSNSSGTIFQKTSVQKRLSSGSSSSSKNKRSTAVVMSSPDCE 828 >10_08_1037 - 22477358-22478752 Length = 464 Score = 26.6 bits (56), Expect = 5.0 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = -2 Query: 285 HHRGPAPRHSGNTRRPKPTELSACCRERSETPRHRNKPSRPV 160 H + P PRHS R P S P+H++ P RP+ Sbjct: 220 HQQEPVPRHSPAAHRGDPLPAS------PPQPQHQHHPHRPL 255 >09_04_0507 + 18194320-18195081 Length = 253 Score = 26.6 bits (56), Expect = 5.0 Identities = 17/59 (28%), Positives = 21/59 (35%) Frame = +3 Query: 144 DSVETKQVEKVYSGDGASLSAPGSKRSALSASDAECFRCAWAPGLCGGPDVPAHGSAPP 320 D E S GAS A G + + A DAE A P + A +A P Sbjct: 115 DEEEDASTASPASAPGASEEAEGEEEAPAGAPDAEAEEAASGPSEASSEEPSAAAAAAP 173 >08_01_0619 + 5412058-5413224,5413357-5413476,5413755-5413831, 5414201-5414321 Length = 494 Score = 26.6 bits (56), Expect = 5.0 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -2 Query: 267 PRHSGNTRRPKPTELSACCRERSETPRHR 181 PR G RRPKP RE S+ +H+ Sbjct: 273 PRIGGGGRRPKPKAREPNKREMSDEEKHK 301 >05_04_0347 + 20479682-20479753,20480136-20480813,20481143-20482195, 20482345-20482406,20482491-20482541,20482635-20482719, 20483253-20483342,20483472-20483563,20483704-20483728 Length = 735 Score = 26.6 bits (56), Expect = 5.0 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +3 Query: 87 IQQLNCSSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPGS 215 +QQ N + ++ Y+G+G DS +T E V + D AS S G+ Sbjct: 89 LQQQNQQTELNLDYSGDGSDSSQTG--EDVPTADQASPSGSGT 129 Score = 25.8 bits (54), Expect = 8.7 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 290 RTTTEARRPGTAETLGVRSRQS*ALAAGSAQRRPVT 183 R +T RRP T E V S + +A+RRP+T Sbjct: 360 RPSTPNRRPMTRELAPVHSSIATPRRPSTAERRPIT 395 >04_01_0617 - 8076624-8076971,8077761-8077883,8077965-8078035, 8078108-8078360,8078613-8078768,8078854-8079770, 8079858-8079927,8082310-8082416,8082722-8082755, 8083621-8083940,8084031-8084820,8084890-8085046, 8085647-8086068 Length = 1255 Score = 26.6 bits (56), Expect = 5.0 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -2 Query: 267 PRHSGNTRRPKPTELSA--CCRERSETPRHRNKPSRPVWS 154 P ++R+PKP A CR S RHR + W+ Sbjct: 31 PISPASSRKPKPNRARAGTLCRSSSRAERHRGGRTSTRWA 70 >03_04_0163 + 17865529-17865801,17866030-17866102,17866251-17866270 Length = 121 Score = 26.6 bits (56), Expect = 5.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 128 QWKWCGLRRDQTGREG 175 +W W GLRR + GR G Sbjct: 49 RWMWRGLRRTKAGRRG 64 >02_05_1113 + 34207997-34208380 Length = 127 Score = 26.6 bits (56), Expect = 5.0 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = -2 Query: 336 RRSPLRAVQSREQGH--QDHHRGPAPRHSGNTRRPKPTELSACCRERSETPRHRNKPSRP 163 RR+P+ E+G + RGP R + RR +AC + S +H + S+P Sbjct: 52 RRTPVADGDGSEEGGCGRGRRRGPRSRPARTARR------AACAEDGSGRGQHGGRRSQP 105 Query: 162 VWSRRS 145 +RR+ Sbjct: 106 GTARRA 111 >01_01_1081 + 8504035-8504461,8504546-8504685 Length = 188 Score = 26.6 bits (56), Expect = 5.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 318 AVQSREQGHQDHHRGPAPRHSGN 250 AV S EQGH+ +GP+P N Sbjct: 119 AVPSLEQGHKGDGQGPSPNEGPN 141 >12_02_1054 - 25721220-25721582,25723163-25723727,25724162-25724476, 25724492-25724772 Length = 507 Score = 26.2 bits (55), Expect = 6.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 191 GVSERSRQQALSSVGFGRRVFPLCLGAGPLW 283 G + RS + +++ RR P+ LGA LW Sbjct: 368 GCNSRSGCRPVAATASARRATPMSLGAAALW 398 >12_02_0118 - 13869237-13869307,13869375-13869465,13870321-13870440, 13870668-13870795,13871159-13871270,13871719-13871817, 13871918-13871992,13872099-13872320,13873177-13874034 Length = 591 Score = 26.2 bits (55), Expect = 6.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 334 PVTPPGGAEP*AGTSGPPQRP 272 P PP GA P G+ PP +P Sbjct: 59 PQAPPPGARPFPGSPPPPSQP 79 >09_04_0032 - 13953323-13955269 Length = 648 Score = 26.2 bits (55), Expect = 6.6 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 210 GSKRSALSASDAECFRCAWAPGLCGGPDVPAHGSAPP 320 G+ ++L+ A F GLCGGP P ++PP Sbjct: 204 GAVPASLAGKPASAFS---GTGLCGGPLSPCTNTSPP 237 >08_01_0489 + 4280063-4280476 Length = 137 Score = 26.2 bits (55), Expect = 6.6 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 11/35 (31%) Frame = -1 Query: 328 TPPGGAEP*AGTSG-----------PPQRPGAQAQ 257 TPPGGA P G+ G PQRPGA A+ Sbjct: 84 TPPGGAGPREGSGGRGGVIHAIADSAPQRPGAPAE 118 >08_01_0488 + 4277482-4277988 Length = 168 Score = 26.2 bits (55), Expect = 6.6 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 11/35 (31%) Frame = -1 Query: 328 TPPGGAEP*AGTSG-----------PPQRPGAQAQ 257 TPPGGA P G+ G PQRPGA A+ Sbjct: 115 TPPGGAGPREGSGGRGGVIHAVADSAPQRPGAPAE 149 >07_03_1495 + 26983415-26984797 Length = 460 Score = 26.2 bits (55), Expect = 6.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -1 Query: 313 AEP*AGTSGPPQRPGAQAQRKHSAS 239 AEP G S PP P + +++H+ S Sbjct: 9 AEPEPGPSSPPPPPETETEQEHAGS 33 >06_03_0786 - 24579722-24580137,24580518-24580590 Length = 162 Score = 26.2 bits (55), Expect = 6.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 128 QWKWCGLRRDQTGREGL 178 +W W GLRR + GR G+ Sbjct: 144 RWMWRGLRRMKDGRRGM 160 >05_07_0146 + 28018236-28018580,28018670-28018777,28018984-28019148, 28019269-28019736,28019823-28019936,28020038-28020715 Length = 625 Score = 26.2 bits (55), Expect = 6.6 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = -2 Query: 294 HQDHHRGPAPRHSGNTRRPKPTELSACCRERSETP 190 H DHH P H G R P E + E P Sbjct: 275 HFDHHNHHHPIHGGRERGSSPAEADHHRHHQQEQP 309 >05_06_0186 - 26207298-26208548,26208743-26208853,26209286-26209507, 26209623-26209658 Length = 539 Score = 26.2 bits (55), Expect = 6.6 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = -2 Query: 336 RRSPLRAVQSREQGHQDHHRGPAPRHSGNTRRPKPTELSAC 214 RR PLR + H P P R+P PT +AC Sbjct: 21 RRRPLRLLPGNRTPH------PPPPQGSRPRKPAPTPAAAC 55 >04_03_0073 - 10702352-10702619,10702702-10702836,10702915-10703594 Length = 360 Score = 26.2 bits (55), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -1 Query: 334 PVTPPGGAEP*AGTSGPPQRPGAQAQRKHSAS 239 P T PGG P S P RP AQ +H+ S Sbjct: 24 PTTAPGGRPPKRHASAPSARP---AQDRHAQS 52 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 26.2 bits (55), Expect = 6.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 337 PPVTPPGGAEP*AGTSGPPQRPGAQA 260 PP PP G G GPP PGA A Sbjct: 1184 PPPPPPRGH---GGVGGPPTPPGAPA 1206 >03_02_1029 - 13488535-13493037 Length = 1500 Score = 26.2 bits (55), Expect = 6.6 Identities = 18/61 (29%), Positives = 26/61 (42%) Frame = -2 Query: 330 SPLRAVQSREQGHQDHHRGPAPRHSGNTRRPKPTELSACCRERSETPRHRNKPSRPVWSR 151 +P S +Q Q PAPR R P+P + ++ + PR +PV SR Sbjct: 270 NPYPGGSSSQQQQQQQPPRPAPRPQFVVRVPQPQQQQN--QQGTRAPRPPTPTVQPVQSR 327 Query: 150 R 148 R Sbjct: 328 R 328 >02_05_1293 - 35520733-35520963,35521696-35521878,35522040-35522255, 35522936-35523022,35523125-35523331,35523426-35523650, 35523743-35523798,35524009-35524115,35524443-35525470 Length = 779 Score = 26.2 bits (55), Expect = 6.6 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = -1 Query: 307 P*AGTSGPPQRPGAQAQRKHSASEADRAERLLPGA 203 P AG S P G + R H + ADR LLPGA Sbjct: 54 PAAGASPPDDGDGPTSSRAHIRALADRF--LLPGA 86 >02_04_0179 + 20682852-20684510,20684593-20684661,20684741-20684809, 20686779-20688206 Length = 1074 Score = 26.2 bits (55), Expect = 6.6 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -1 Query: 337 PPVTPPGGAEP*AGTSGPPQRPGAQ-AQRKHSASEADRAERLLPGALRDAPSP 182 PP G AE AG PPQ P A + E RA G D P P Sbjct: 56 PPPPATGSAEEVAGNGEPPQPPATDPASEPTAPPEPQRATEEKKG---DEPPP 105 >01_06_0499 + 29823578-29823754,29823882-29824002,29825103-29825227, 29825338-29825432,29825890-29825994,29826103-29826899, 29827100-29827154,29827930-29828035,29828126-29828268, 29828816-29829038 Length = 648 Score = 26.2 bits (55), Expect = 6.6 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -1 Query: 328 TPPGGAEP*AGTSGPPQRPGAQAQRKHSASEADRAER 218 TPP + P G SG Q P A A H A+ A + R Sbjct: 14 TPPARSLPPLGASGSQQEPAATA--SHHAAGAGASSR 48 >12_02_0442 - 19118536-19119222 Length = 228 Score = 25.8 bits (54), Expect = 8.7 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -1 Query: 337 PPVTPPGGAEP*AGTSGPPQRPGAQAQRKHSASEADR 227 PP+ PP P A T+ P +R + A A+E R Sbjct: 131 PPLDPPPPPLPAAATAAPHRRQSSSAADGELAAERGR 167 >10_08_0929 + 21633179-21633377,21633466-21633809,21633905-21634297 Length = 311 Score = 25.8 bits (54), Expect = 8.7 Identities = 20/50 (40%), Positives = 23/50 (46%), Gaps = 7/50 (14%) Frame = -2 Query: 270 APRHSGNTRRPKPTELSAC--C-RERSETPRHRNK----PSRPVWSRRSP 142 AP H R P PT L+ C C R S RN P+RPV +R P Sbjct: 253 APHHLYGARVPPPTTLTMCPSCERVASAATTTRNNSGAAPARPVPTRPWP 302 >08_02_0833 - 21623721-21623821,21624076-21624667 Length = 230 Score = 25.8 bits (54), Expect = 8.7 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 131 WK-WCGLRRDQTGREGLFR*RGVSERSRQQALSSVGFGRR 247 WK WC RR+ +R GV R R++ S V +GR+ Sbjct: 90 WKAWC--RRESRRWPSSWRGEGVRWRMRRERRSGVSWGRK 127 >08_01_0133 + 1062365-1063057,1063210-1063318,1063914-1064005, 1064399-1064560,1064718-1064834,1065029-1065127 Length = 423 Score = 25.8 bits (54), Expect = 8.7 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 5/44 (11%) Frame = -2 Query: 279 RGPAPRHSGNTRRPKPTELSACCRER-----SETPRHRNKPSRP 163 R PA + P T L+ C +R S+ PR+RN P P Sbjct: 40 RSPAAASVIHLSPPPVTPLAVACDDRHALPDSDEPRNRNPPDHP 83 >05_03_0446 + 14111667-14111906,14112011-14112418 Length = 215 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 Query: 174 VYSGDGASLSAPGSKR 221 +Y GD AS +APG KR Sbjct: 90 IYDGDAASPAAPGPKR 105 >04_04_0318 + 24347364-24348826,24348920-24349048,24349158-24349293, 24349447-24349535,24349631-24349742,24349836-24349942, 24350033-24350129 Length = 710 Score = 25.8 bits (54), Expect = 8.7 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = -2 Query: 336 RRSPLRAVQSREQGHQDHHRGPAPRHSGNTRRPK 235 R L A SR Q HH P+ RH P+ Sbjct: 15 RERELDAEASRRSKEQQHHHHPSGRHQRGDSDPR 48 >04_03_1004 + 21637910-21638269,21638424-21638579,21640108-21640202, 21640478-21640505,21640725-21640752,21642353-21642363 Length = 225 Score = 25.8 bits (54), Expect = 8.7 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -2 Query: 279 RGPAPRHSGNTRRPKPTELSACCRERSET 193 RGP PR +G +RP P A R S + Sbjct: 10 RGPPPRPAGRAQRPPPPHSVAPKRASSSS 38 >01_06_0691 - 31268729-31269010,31269596-31270051,31270560-31271735 Length = 637 Score = 25.8 bits (54), Expect = 8.7 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -2 Query: 207 ERSETPRHRNKPSRPVWSRRSPHH 136 +R TP R KPS P RSP H Sbjct: 263 KRFSTPPPRRKPSSPPAPSRSPPH 286 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 25.8 bits (54), Expect = 8.7 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = -2 Query: 273 PAPRHSGNTRRPKPTELSACCRERSETPRHRNKPSRPVWSR 151 P P N P P ++ + +P H PSRP+ S+ Sbjct: 34 PPPISPQNPTPPPPPLPASAAAPTTPSPNHSGDPSRPIPSQ 74 >01_04_0116 + 16189250-16189411,16189577-16190104 Length = 229 Score = 25.8 bits (54), Expect = 8.7 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 208 PAASAQLCRLRTPSVSAVPGRRASVVVLM 294 P + LCR PS +A+PG + LM Sbjct: 33 PVSGTALCRHHRPSATALPGYMGIEIQLM 61 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,851,800 Number of Sequences: 37544 Number of extensions: 242233 Number of successful extensions: 1238 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 1167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1238 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 471517020 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -