BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0823 (598 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK128672-1|BAC87563.1| 141|Homo sapiens protein ( Homo sapiens ... 30 5.4 AJ389195-1|CAB51735.1| 131|Homo sapiens immunoglobulin heavy ch... 29 9.5 >AK128672-1|BAC87563.1| 141|Homo sapiens protein ( Homo sapiens cDNA FLJ46835 fis, clone UTERU2028377. ). Length = 141 Score = 30.3 bits (65), Expect = 5.4 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 6/53 (11%) Frame = +2 Query: 281 ELISQGGWRIYVVDGLQ*PLNTRLAVSSSTHLSNKKNSI------WCCI*NPS 421 EL+ G WR+ PL++RL + HL+N K SI WC + PS Sbjct: 65 ELLEPGRWRLRWAGTA--PLHSRLGKRARLHLNNNKKSIEVAKYYWCIVYLPS 115 >AJ389195-1|CAB51735.1| 131|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 131 Score = 29.5 bits (63), Expect = 9.5 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -3 Query: 434 HCSKWKDFKYSTIYYFFYCLDGW 366 +C++ K +Y T YY++Y +D W Sbjct: 94 YCARAKLLQYPTYYYYYYGMDVW 116 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,442,428 Number of Sequences: 237096 Number of extensions: 1983415 Number of successful extensions: 3047 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3046 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6324506272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -