BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0821 (597 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37524| Best HMM Match : p450 (HMM E-Value=0) 28 5.0 SB_51594| Best HMM Match : p450 (HMM E-Value=3.5e-35) 27 8.7 >SB_37524| Best HMM Match : p450 (HMM E-Value=0) Length = 362 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/46 (23%), Positives = 27/46 (58%) Frame = +3 Query: 360 LKMAISYVMTTYNVNLYHTLHKKLSEAVASAGLPDIAGSQDIPVLD 497 L A+ Y++ +N ++ LHK++ + + P ++ +++PVL+ Sbjct: 177 LGWAVIYLL--HNPDVQERLHKEIDDVIGRDAFPQLSKRKELPVLE 220 >SB_51594| Best HMM Match : p450 (HMM E-Value=3.5e-35) Length = 1208 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/46 (28%), Positives = 27/46 (58%) Frame = +3 Query: 360 LKMAISYVMTTYNVNLYHTLHKKLSEAVASAGLPDIAGSQDIPVLD 497 L AI+Y++ +N + LHK++ + + P ++ ++IPVL+ Sbjct: 1077 LSWAIAYLL--HNPGVQARLHKEIDQVIGRDVSPKLSQRKNIPVLE 1120 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,284,459 Number of Sequences: 59808 Number of extensions: 379340 Number of successful extensions: 817 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 759 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -