BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0820 (586 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 23 2.2 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 23 2.2 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 2.2 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 8.9 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -3 Query: 164 LKSSQFNLFSSHQLTSLSCLFIPET 90 LK+S F F+SH++ S LF+ +T Sbjct: 468 LKASPF--FASHEVVGSSLLFVHDT 490 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -3 Query: 164 LKSSQFNLFSSHQLTSLSCLFIPET 90 LK+S F F+SH++ S LF+ +T Sbjct: 383 LKASPF--FASHEVVGSSLLFVHDT 405 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -3 Query: 164 LKSSQFNLFSSHQLTSLSCLFIPET 90 LK+S F F+SH++ S LF+ +T Sbjct: 702 LKASPF--FASHEVVGSSLLFVHDT 724 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/32 (21%), Positives = 16/32 (50%) Frame = -3 Query: 263 NIMINQILTYIFKKDCFNYTDNPTIDLPCTYS 168 +I+ L + + +C+ Y N ++ C Y+ Sbjct: 308 HILQKTTLNMLTQVECYKYYGNIMVNAMCAYA 339 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,324 Number of Sequences: 438 Number of extensions: 3264 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -