BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0819 (636 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 30 1.3 01_06_0358 - 28677781-28677901,28678327-28678430,28678542-286786... 29 3.1 06_03_0765 + 24421982-24422120,24422287-24422367,24422722-244229... 28 5.4 03_05_0432 - 24231984-24233048,24233391-24235160,24235261-242365... 28 7.1 05_01_0111 - 752045-752641 27 9.4 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/50 (26%), Positives = 30/50 (60%) Frame = +3 Query: 264 ASATTHFLESKHKRIYDKLAKAANEQLQVNDKRTNKGXSRGLNAKNALSR 413 A+ATT+F + + + +++ K + ++L + +R + G SRG + ++R Sbjct: 252 ANATTNFPKESYVKEIEEMQKMSKQELVASLRRKSSGFSRGASIYRGVTR 301 >01_06_0358 - 28677781-28677901,28678327-28678430,28678542-28678625, 28679221-28679265,28679523-28679594,28679721-28679759, 28679966-28680061,28680492-28680566,28681717-28681764, 28681888-28681971,28682141-28682341,28682394-28682561, 28683232-28683372,28683470-28683517,28683845-28684087, 28684184-28684297,28685134-28685163,28685361-28685951, 28686033-28686620,28686744-28686863,28687764-28687938, 28688397-28688562,28688653-28688755,28689227-28689319, 28690759-28690918,28691754-28691872 Length = 1275 Score = 29.1 bits (62), Expect = 3.1 Identities = 21/83 (25%), Positives = 37/83 (44%) Frame = -1 Query: 390 LNHVIXLYSYVCR*LVTVRLQLSLICHKSFYV*TLRNALLHLLQHCIYWCINFVAC*ALK 211 L H+ +Y + + V L S + + +++ T +L + CI+W I + L Sbjct: 967 LQHLFNVYGRSPKVVKQVLLSTSKVLNFDYWITTTVCSLRRKIMQCIHWHIPNLILQTLT 1026 Query: 210 RVFQHSVESVVSTKLHIYLYQLK 142 S E V + K H+Y +LK Sbjct: 1027 EDSTPSAELVAAVK-HLYKTKLK 1048 >06_03_0765 + 24421982-24422120,24422287-24422367,24422722-24422962, 24423078-24423171,24423513-24423729,24423818-24423909, 24424303-24424638 Length = 399 Score = 28.3 bits (60), Expect = 5.4 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +1 Query: 448 DDNRPTGIXMLSIEKFIX*FFIAXPGAPSXLGPXQSIVLP 567 DD+ + L + + F+A PG + +GP + VLP Sbjct: 125 DDDEAASLRWLDVGLYTSRIFMAVPGCSTMVGPMNTEVLP 164 >03_05_0432 - 24231984-24233048,24233391-24235160,24235261-24236582, 24236668-24237013 Length = 1500 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/57 (24%), Positives = 32/57 (56%) Frame = +3 Query: 255 NVEASATTHFLESKHKRIYDKLAKAANEQLQVNDKRTNKGXSRGLNAKNALSRQLVI 425 N+E + H L+ KH+ + +K A+ E+L ++ + + + A+ +L +QL++ Sbjct: 229 NLELNKLKHMLKQKHEELNEKQAEL--EKLNISTEEEHLKCMQAEMAQLSLEKQLIL 283 >05_01_0111 - 752045-752641 Length = 198 Score = 27.5 bits (58), Expect = 9.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 109 LESHITSQEHLFQLVQVDVEFGAYNGLYRVLENAFQCLTCNEVY 240 + SH ++ L V V + A G R E AF C TCN V+ Sbjct: 18 MSSHGQQEQALALPVPVQLPLAAARG-DRAPERAFVCKTCNRVF 60 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,602,534 Number of Sequences: 37544 Number of extensions: 245174 Number of successful extensions: 536 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 536 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -