BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0816 (501 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0511 + 25056018-25059107 30 1.2 01_01_0115 - 856957-858055,858479-858538,858802-859583 28 3.7 >03_05_0511 + 25056018-25059107 Length = 1029 Score = 29.9 bits (64), Expect = 1.2 Identities = 18/71 (25%), Positives = 31/71 (43%) Frame = +2 Query: 239 FEVHREGKFFNKKLPLTTSYERLVLAMYPVYFCREAVMRFGLKGEAARCXYTETLELISX 418 F +H+ +F+ KLP + L P YF ++ M G KG +E + Sbjct: 226 FRIHQFAEFYAAKLPNINANALLKGLWGPRYFHKKKKMIVGKKGMEGGDAQPMFVEFVLK 285 Query: 419 GVWRIYRCXMS 451 +W+ Y+ +S Sbjct: 286 PLWQAYQGVLS 296 >01_01_0115 - 856957-858055,858479-858538,858802-859583 Length = 646 Score = 28.3 bits (60), Expect = 3.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 256 FAMNFEYVSKFYIYTTLIYK*LLFCFSEKVH*P 158 FA+ F Y S+FY+Y++ I + C ++ H P Sbjct: 235 FAIRFPYTSRFYVYSSKIKQ----CIAQSFHCP 263 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,709,801 Number of Sequences: 37544 Number of extensions: 183967 Number of successful extensions: 282 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 282 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1059318940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -