BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0816 (501 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC105099-1|AAI05100.1| 369|Homo sapiens C3orf48 protein protein. 29 6.9 BC105097-1|AAI05098.1| 369|Homo sapiens C3orf48 protein protein. 29 6.9 AK058178-1|BAB71705.1| 368|Homo sapiens protein ( Homo sapiens ... 29 6.9 >BC105099-1|AAI05100.1| 369|Homo sapiens C3orf48 protein protein. Length = 369 Score = 29.5 bits (63), Expect = 6.9 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Frame = +2 Query: 245 VHREGKFFNKKLPLTTSYERLVLAMYPV----YFCREAVMRFGLKGEAARCXYTETLELI 412 +H+ KF + +TT ++++ + Y V Y E + K EA RC Y +T + Sbjct: 228 LHQLSKF-DPSYQMTTDEQQIINSFYTVFREEYAAIEDLFSAINKTEAVRCEYEDTHKAF 286 Query: 413 SXGVWRIYR 439 + WR+ R Sbjct: 287 AKAFWRMDR 295 >BC105097-1|AAI05098.1| 369|Homo sapiens C3orf48 protein protein. Length = 369 Score = 29.5 bits (63), Expect = 6.9 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Frame = +2 Query: 245 VHREGKFFNKKLPLTTSYERLVLAMYPV----YFCREAVMRFGLKGEAARCXYTETLELI 412 +H+ KF + +TT ++++ + Y V Y E + K EA RC Y +T + Sbjct: 228 LHQLSKF-DPSYQMTTDEQQIINSFYTVFREEYAAIEDLFSAINKTEAVRCEYEDTHKAF 286 Query: 413 SXGVWRIYR 439 + WR+ R Sbjct: 287 AKAFWRMDR 295 >AK058178-1|BAB71705.1| 368|Homo sapiens protein ( Homo sapiens cDNA FLJ25449 fis, clone TST08763. ). Length = 368 Score = 29.5 bits (63), Expect = 6.9 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Frame = +2 Query: 245 VHREGKFFNKKLPLTTSYERLVLAMYPV----YFCREAVMRFGLKGEAARCXYTETLELI 412 +H+ KF + +TT ++++ + Y V Y E + K EA RC Y +T + Sbjct: 228 LHQLSKF-DPSYQMTTDEQQIINSFYTVFREEYTAIEDLFSAINKTEAVRCEYEDTHKAF 286 Query: 413 SXGVWRIYR 439 + WR+ R Sbjct: 287 AKAFWRMDR 295 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 59,416,109 Number of Sequences: 237096 Number of extensions: 1032866 Number of successful extensions: 1331 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1331 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4593178062 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -