BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0810 (622 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 82 4e-18 AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding pr... 37 2e-04 AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein pro... 36 2e-04 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 2.4 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 3.2 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 22 4.2 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 22 4.2 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 22 4.2 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 21 7.3 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 21 9.7 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 82.2 bits (194), Expect = 4e-18 Identities = 35/63 (55%), Positives = 50/63 (79%) Frame = +3 Query: 66 EFVGKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTE 245 +F+GK+YK+ SSENFD+FMK +GVG++TRK ++V+P VEL ++ Y L T+S FK TE Sbjct: 3 DFLGKRYKLYSSENFDDFMKALGVGIMTRKVGSSVSPVVELTENNGLYTLKTTSPFKNTE 62 Query: 246 MKF 254 +KF Sbjct: 63 IKF 65 Score = 81.4 bits (192), Expect = 6e-18 Identities = 39/66 (59%), Positives = 45/66 (68%) Frame = +2 Query: 260 GEEFEEDRADGAKVKSVCTFEGNTLKQVQKAPDGLEVTYVREFGPEEMKAVMTAKDVTCT 439 GEEFEE+ DG KVKSVCT +GN L QVQK + T REF EMKA+M D+ CT Sbjct: 68 GEEFEEETVDGRKVKSVCTLDGNKLIQVQKGEK--QTTIEREFSSTEMKAIMKVDDIICT 125 Query: 440 RVYKVQ 457 RVYK+Q Sbjct: 126 RVYKIQ 131 >AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding protein protein. Length = 135 Score = 36.7 bits (81), Expect = 2e-04 Identities = 21/64 (32%), Positives = 32/64 (50%) Frame = +3 Query: 63 MEFVGKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTT 242 ++F GK ++ S NF+EF K +G + P+ EL K+GDE+ +SS T Sbjct: 2 VQFEGK-FQFVSQNNFEEFAKVLGDQNLVNTVLQP-RPSFELSKNGDEWTFTSSSGDNTY 59 Query: 243 EMKF 254 F Sbjct: 60 TKTF 63 >AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein protein. Length = 105 Score = 36.3 bits (80), Expect = 2e-04 Identities = 21/63 (33%), Positives = 31/63 (49%) Frame = +3 Query: 66 EFVGKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTE 245 +F GK ++ S NF+EF K +G + P+ EL K+GDE+ +SS T Sbjct: 1 QFEGK-FQFVSQNNFEEFAKVLGDQNLVNTVLQP-RPSFELSKNGDEWTFTSSSGDNTYT 58 Query: 246 MKF 254 F Sbjct: 59 KTF 61 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.0 bits (47), Expect = 2.4 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -1 Query: 475 RSRVLLLDLVDSGASHVLSCHHSFHLLRAEFPDVSDFKTV 356 RSR+ L D G S S + L+R E D D +T+ Sbjct: 25 RSRIARLGRDDGGKSRQSSFEVTSLLMREETEDAEDTQTL 64 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.6 bits (46), Expect = 3.2 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -1 Query: 250 FISVVLKVEEVTKLYSSPSLRSSTV 176 FIS+++ +E+ + +SP L + T+ Sbjct: 9 FISLIILNDEIYNIIASPQLNNPTL 33 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 311 CTFEGNTLKQVQKAPDGL 364 CT EGN LK+V PD L Sbjct: 57 CTAEGNELKRV--LPDAL 72 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 311 CTFEGNTLKQVQKAPDGL 364 CT EGN LK+V PD L Sbjct: 57 CTAEGNELKRV--LPDAL 72 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 311 CTFEGNTLKQVQKAPDGL 364 CT EGN LK+V PD L Sbjct: 57 CTAEGNELKRV--LPDAL 72 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 280 VLFELFAGLNFISVVLKVEEVTKL 209 V FEL + I+ V+ +E++TKL Sbjct: 78 VYFELLSPNRTINSVVYIEQLTKL 101 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/48 (20%), Positives = 24/48 (50%) Frame = +2 Query: 326 NTLKQVQKAPDGLEVTYVREFGPEEMKAVMTAKDVTCTRVYKVQ*KDS 469 + +K + +PD +E ++ E + + KDV+ ++ +Q D+ Sbjct: 184 SNIKVISISPDLVETDMTAQWLKENSRLALKPKDVSNCVLFALQTPDN 231 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,806 Number of Sequences: 438 Number of extensions: 2797 Number of successful extensions: 17 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -