BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0800 (597 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0225 - 1650665-1652743 34 0.099 07_03_1626 + 28223967-28225294,28225506-28225779,28225939-282262... 27 8.6 >07_01_0225 - 1650665-1652743 Length = 692 Score = 33.9 bits (74), Expect = 0.099 Identities = 17/31 (54%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -2 Query: 254 HPCVFF--LVGINQSFHWHFSFFAFLLVSFG 168 HPC+F V + Q+ H F FF FLLVSFG Sbjct: 7 HPCIFLDLFVQVRQTSHTKF-FFLFLLVSFG 36 >07_03_1626 + 28223967-28225294,28225506-28225779,28225939-28226230, 28226492-28226651,28226809-28226917,28227004-28227099 Length = 752 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 538 EKPEPEFET*RMDLELFKKS 597 E+PE EFE R++LELF S Sbjct: 543 EQPEYEFEAVRLELELFSPS 562 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,100,964 Number of Sequences: 37544 Number of extensions: 160639 Number of successful extensions: 249 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 249 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -