BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0800 (597 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 26 1.1 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 23 9.9 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 25.8 bits (54), Expect = 1.1 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -2 Query: 158 GPSPSDYHESF*LDNFTKEKFTFVATYNYFKNTVKAGRYASPV 30 G +P D+ ESF +E T V +Y K T RYA P+ Sbjct: 166 GENPPDHVESFERSGLREEVMTNVRKSSYTKPT-PIQRYAIPI 207 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 22.6 bits (46), Expect = 9.9 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +2 Query: 125 RMTRGNQRDLARAKNQKKQVEMQKKKNASEKT-GLSLQER 241 R + +Q L N+K Q+E KK SEK L QE+ Sbjct: 408 REQKSDQDRLDSEINKKAQIEENYKKIESEKNEALKRQEK 447 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 451,635 Number of Sequences: 2352 Number of extensions: 7489 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -