BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0791 (590 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 23 1.7 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 5.2 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 6.8 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 6.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 6.8 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 9.0 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 23.4 bits (48), Expect = 1.7 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -1 Query: 224 QESRCWFISHSYFV 183 +++R W I+HSYF+ Sbjct: 223 EQNRSWRITHSYFM 236 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 5.2 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +3 Query: 327 PCGPPPEKPED*TLRF 374 PC PP P++ T+ F Sbjct: 313 PCTQPPSAPQNLTVNF 328 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.4 bits (43), Expect = 6.8 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = +2 Query: 56 NFRVYTISTSILPLKIKWVKDTTFTVNLNIYRANI*AQATPTLQNMNGL 202 +FR + +STSIL K ++T + + + RA ++ ++ + NG+ Sbjct: 398 SFREFAVSTSILGDKKTAEENTDYFMPIGRPRAKDYGHSSGSVIDRNGV 446 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +2 Query: 479 N*SIQIVPPKLNLLSIKTTN 538 N ++ + PKL++ +KT+N Sbjct: 145 NRTVPVCAPKLHVFDLKTSN 164 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 71 TISTSILPLKIKWVKD 118 +++ LPL I W+KD Sbjct: 633 SVTRGDLPLSISWLKD 648 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/37 (24%), Positives = 14/37 (37%) Frame = +1 Query: 82 KHLAFKNKMGERYNIHSQLEHLQSKYIGTGHADTTKY 192 K+ N +G R + S+Y + H D Y Sbjct: 209 KYAISSNSLGSRSRSFQRTSSCHSRYEDSRHEDRNSY 245 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,486 Number of Sequences: 438 Number of extensions: 2722 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17237673 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -