BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0779 (557 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 4.1 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 5.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 5.4 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 7.2 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.2 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.8 bits (44), Expect = 4.1 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +1 Query: 373 TYVCVCMPEFT 405 +Y+C C P FT Sbjct: 44 SYICTCKPGFT 54 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 5.4 Identities = 10/41 (24%), Positives = 17/41 (41%) Frame = -1 Query: 380 TYVMKHTSIHFSRTTGLICSNSKPLHSQFNIITYNDHDNNL 258 T + K H + +C N + ++ TYN+ N L Sbjct: 318 TNLEKSNLNHNEQLRKYLCKNEDETKNHYSKNTYNEQGNKL 358 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 5.4 Identities = 10/41 (24%), Positives = 17/41 (41%) Frame = -1 Query: 380 TYVMKHTSIHFSRTTGLICSNSKPLHSQFNIITYNDHDNNL 258 T + K H + +C N + ++ TYN+ N L Sbjct: 210 TNLEKSNLNHNEQLRKYLCKNEDETKNHYSKNTYNEQGNKL 250 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 7.2 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +1 Query: 373 TYVCVCMPEFTCXVAL 420 TY+C +F+C V + Sbjct: 142 TYICYAFGKFSCKVMI 157 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 7.2 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +1 Query: 373 TYVCVCMPEFTCXVAL 420 TY+C +F+C V + Sbjct: 375 TYICYAFGKFSCKVMI 390 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 7.2 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +1 Query: 373 TYVCVCMPEFTCXVAL 420 TY+C +F+C V + Sbjct: 375 TYICYAFGKFSCKVMI 390 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,776 Number of Sequences: 336 Number of extensions: 2163 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13681771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -