BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0779 (557 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT004839-1|AAO45195.1| 311|Drosophila melanogaster RH24769p pro... 57 1e-08 AY314744-1|AAP79432.1| 311|Drosophila melanogaster nervana 3 pr... 57 1e-08 AF202633-1|AAF17587.1| 311|Drosophila melanogaster Na/K-ATPase ... 57 1e-08 AE014134-3399|AAN11122.1| 311|Drosophila melanogaster CG8663-PD... 57 1e-08 AE014134-3398|AAN11121.1| 311|Drosophila melanogaster CG8663-PC... 57 1e-08 AE014134-3397|AAF53996.1| 311|Drosophila melanogaster CG8663-PB... 57 1e-08 AE014134-3396|AAF53995.1| 311|Drosophila melanogaster CG8663-PA... 57 1e-08 BT025048-1|ABE73219.1| 322|Drosophila melanogaster IP16413p pro... 52 5e-07 AY060289-1|AAL25328.1| 323|Drosophila melanogaster GH13134p pro... 52 5e-07 AE014134-1170|AAX52660.1| 322|Drosophila melanogaster CG9261-PE... 52 5e-07 AE014134-1169|AAF52439.1| 322|Drosophila melanogaster CG9261-PD... 52 5e-07 AE014134-1168|AAF52438.2| 322|Drosophila melanogaster CG9261-PA... 52 5e-07 AE014134-1167|AAX52659.1| 323|Drosophila melanogaster CG9261-PF... 52 5e-07 AE014134-1166|AAN10600.1| 323|Drosophila melanogaster CG9261-PC... 52 5e-07 U22440-1|AAC46610.1| 323|Drosophila melanogaster nervous system... 50 2e-06 U22439-1|AAC46609.1| 322|Drosophila melanogaster nervous system... 50 2e-06 U22438-1|AAC46608.1| 309|Drosophila melanogaster nervous system... 37 0.016 AY122147-1|AAM52659.1| 309|Drosophila melanogaster LD02379p pro... 37 0.021 AE014134-1165|AAF52437.1| 309|Drosophila melanogaster CG9258-PA... 37 0.021 AE014298-2398|AAF48605.1| 1060|Drosophila melanogaster CG9981-PA... 29 3.2 AY075243-1|AAL68110.1| 407|Drosophila melanogaster AT20832p pro... 29 4.3 AE013599-2963|AAF57510.1| 407|Drosophila melanogaster CG16898-P... 29 4.3 >BT004839-1|AAO45195.1| 311|Drosophila melanogaster RH24769p protein. Length = 311 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 NIECKAWA+NI +DR +RRGSVHFELMVD Sbjct: 283 NIECKAWARNINHDRSDRRGSVHFELMVD 311 >AY314744-1|AAP79432.1| 311|Drosophila melanogaster nervana 3 protein. Length = 311 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 NIECKAWA+NI +DR +RRGSVHFELMVD Sbjct: 283 NIECKAWARNINHDRSDRRGSVHFELMVD 311 >AF202633-1|AAF17587.1| 311|Drosophila melanogaster Na/K-ATPase beta subunit isoform 3 protein. Length = 311 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 NIECKAWA+NI +DR +RRGSVHFELMVD Sbjct: 283 NIECKAWARNINHDRSDRRGSVHFELMVD 311 >AE014134-3399|AAN11122.1| 311|Drosophila melanogaster CG8663-PD, isoform D protein. Length = 311 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 NIECKAWA+NI +DR +RRGSVHFELMVD Sbjct: 283 NIECKAWARNINHDRSDRRGSVHFELMVD 311 >AE014134-3398|AAN11121.1| 311|Drosophila melanogaster CG8663-PC, isoform C protein. Length = 311 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 NIECKAWA+NI +DR +RRGSVHFELMVD Sbjct: 283 NIECKAWARNINHDRSDRRGSVHFELMVD 311 >AE014134-3397|AAF53996.1| 311|Drosophila melanogaster CG8663-PB, isoform B protein. Length = 311 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 NIECKAWA+NI +DR +RRGSVHFELMVD Sbjct: 283 NIECKAWARNINHDRSDRRGSVHFELMVD 311 >AE014134-3396|AAF53995.1| 311|Drosophila melanogaster CG8663-PA, isoform A protein. Length = 311 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 NIECKAWA+NI +DR +RRGSVHFELMVD Sbjct: 283 NIECKAWARNINHDRSDRRGSVHFELMVD 311 >BT025048-1|ABE73219.1| 322|Drosophila melanogaster IP16413p protein. Length = 322 Score = 52.0 bits (119), Expect = 5e-07 Identities = 19/29 (65%), Positives = 26/29 (89%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 N+EC+AWA+NI +DR ER GSVH+EL++D Sbjct: 294 NVECRAWARNIIHDRKERIGSVHYELLID 322 >AY060289-1|AAL25328.1| 323|Drosophila melanogaster GH13134p protein. Length = 323 Score = 52.0 bits (119), Expect = 5e-07 Identities = 19/29 (65%), Positives = 26/29 (89%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 N+EC+AWA+NI +DR ER GSVH+EL++D Sbjct: 295 NVECRAWARNIIHDRKERIGSVHYELLID 323 >AE014134-1170|AAX52660.1| 322|Drosophila melanogaster CG9261-PE, isoform E protein. Length = 322 Score = 52.0 bits (119), Expect = 5e-07 Identities = 19/29 (65%), Positives = 26/29 (89%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 N+EC+AWA+NI +DR ER GSVH+EL++D Sbjct: 294 NVECRAWARNIIHDRKERIGSVHYELLID 322 >AE014134-1169|AAF52439.1| 322|Drosophila melanogaster CG9261-PD, isoform D protein. Length = 322 Score = 52.0 bits (119), Expect = 5e-07 Identities = 19/29 (65%), Positives = 26/29 (89%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 N+EC+AWA+NI +DR ER GSVH+EL++D Sbjct: 294 NVECRAWARNIIHDRKERIGSVHYELLID 322 >AE014134-1168|AAF52438.2| 322|Drosophila melanogaster CG9261-PA, isoform A protein. Length = 322 Score = 52.0 bits (119), Expect = 5e-07 Identities = 19/29 (65%), Positives = 26/29 (89%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 N+EC+AWA+NI +DR ER GSVH+EL++D Sbjct: 294 NVECRAWARNIIHDRKERIGSVHYELLID 322 >AE014134-1167|AAX52659.1| 323|Drosophila melanogaster CG9261-PF, isoform F protein. Length = 323 Score = 52.0 bits (119), Expect = 5e-07 Identities = 19/29 (65%), Positives = 26/29 (89%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 N+EC+AWA+NI +DR ER GSVH+EL++D Sbjct: 295 NVECRAWARNIIHDRKERIGSVHYELLID 323 >AE014134-1166|AAN10600.1| 323|Drosophila melanogaster CG9261-PC, isoform C protein. Length = 323 Score = 52.0 bits (119), Expect = 5e-07 Identities = 19/29 (65%), Positives = 26/29 (89%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 N+EC+AWA+NI +DR ER GSVH+EL++D Sbjct: 295 NVECRAWARNIIHDRKERIGSVHYELLID 323 >U22440-1|AAC46610.1| 323|Drosophila melanogaster nervous system antigen 2 protein. Length = 323 Score = 50.4 bits (115), Expect = 2e-06 Identities = 19/29 (65%), Positives = 25/29 (86%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 N+EC+AWA+NI DR ER GSVH+EL++D Sbjct: 295 NVECRAWARNIIRDRKERIGSVHYELLID 323 >U22439-1|AAC46609.1| 322|Drosophila melanogaster nervous system antigen 2 protein. Length = 322 Score = 50.4 bits (115), Expect = 2e-06 Identities = 19/29 (65%), Positives = 25/29 (86%) Frame = +3 Query: 3 NIECKAWAKNIFYDRYERRGSVHFELMVD 89 N+EC+AWA+NI DR ER GSVH+EL++D Sbjct: 294 NVECRAWARNIIRDRKERIGSVHYELLID 322 >U22438-1|AAC46608.1| 309|Drosophila melanogaster nervous system antigen 1 protein. Length = 309 Score = 37.1 bits (82), Expect = 0.016 Identities = 15/31 (48%), Positives = 24/31 (77%), Gaps = 2/31 (6%) Frame = +3 Query: 3 NIECKAWAKNIFY--DRYERRGSVHFELMVD 89 ++EC+AWAKNI Y +R+GSV F++++D Sbjct: 279 DVECRAWAKNIQYSGSARDRKGSVTFQILLD 309 >AY122147-1|AAM52659.1| 309|Drosophila melanogaster LD02379p protein. Length = 309 Score = 36.7 bits (81), Expect = 0.021 Identities = 15/31 (48%), Positives = 24/31 (77%), Gaps = 2/31 (6%) Frame = +3 Query: 3 NIECKAWAKNIFYDR--YERRGSVHFELMVD 89 ++EC+AWAKNI Y +R+GSV F++++D Sbjct: 279 DVECRAWAKNIQYSGSVRDRKGSVTFQILLD 309 >AE014134-1165|AAF52437.1| 309|Drosophila melanogaster CG9258-PA protein. Length = 309 Score = 36.7 bits (81), Expect = 0.021 Identities = 15/31 (48%), Positives = 24/31 (77%), Gaps = 2/31 (6%) Frame = +3 Query: 3 NIECKAWAKNIFYDR--YERRGSVHFELMVD 89 ++EC+AWAKNI Y +R+GSV F++++D Sbjct: 279 DVECRAWAKNIQYSGSVRDRKGSVTFQILLD 309 >AE014298-2398|AAF48605.1| 1060|Drosophila melanogaster CG9981-PA protein. Length = 1060 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +1 Query: 88 TALKHTACWPRSSLSDPVAIPSRVTLLRSFSVKVINCIKLAPGELKVV 231 TALK S SD + +RVT++R+ ++IN + PG+L VV Sbjct: 87 TALKEGLEDYSRSKSDKLVNTARVTVIRNGKEEIINSQFIVPGDLVVV 134 >AY075243-1|AAL68110.1| 407|Drosophila melanogaster AT20832p protein. Length = 407 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 281 YNDHDNNLQSVTYELHTTTFSSPGANLIQFMTLTLND 171 Y+D N +V + + F+SP +L QF T++L D Sbjct: 260 YDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLRD 296 >AE013599-2963|AAF57510.1| 407|Drosophila melanogaster CG16898-PA protein. Length = 407 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 281 YNDHDNNLQSVTYELHTTTFSSPGANLIQFMTLTLND 171 Y+D N +V + + F+SP +L QF T++L D Sbjct: 260 YDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLRD 296 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,189,540 Number of Sequences: 53049 Number of extensions: 417331 Number of successful extensions: 1008 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 988 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2151905496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -