BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0775 (582 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC040291-1|AAH40291.1| 608|Homo sapiens family with sequence si... 29 9.1 AK074156-1|BAB84982.1| 627|Homo sapiens FLJ00229 protein protein. 29 9.1 >BC040291-1|AAH40291.1| 608|Homo sapiens family with sequence similarity 116, member A protein. Length = 608 Score = 29.5 bits (63), Expect = 9.1 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 533 PPHNAHCVGMTAFCTRFLSQLDCESSLRCWLKLF 432 P N+ C+G T FC RF SL C L F Sbjct: 102 PDSNSGCLGDTQFCFRFRQSSGRRVSLHCLLDQF 135 >AK074156-1|BAB84982.1| 627|Homo sapiens FLJ00229 protein protein. Length = 627 Score = 29.5 bits (63), Expect = 9.1 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 533 PPHNAHCVGMTAFCTRFLSQLDCESSLRCWLKLF 432 P N+ C+G T FC RF SL C L F Sbjct: 121 PDSNSGCLGDTQFCFRFRQSSGRRVSLHCLLDQF 154 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,568,024 Number of Sequences: 237096 Number of extensions: 1537819 Number of successful extensions: 2271 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2271 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6042162242 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -