BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0771 (570 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1105.08 |||EMP70 family|Schizosaccharomyces pombe|chr 2|||Ma... 27 2.6 SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10 |Schizosac... 26 4.5 SPAC1039.04 |||nicotinic acid plasma membrane transporter |Schiz... 25 5.9 SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 7.8 SPAC24H6.06 |sld3|mug175|DNA replication pre-initiation complex ... 25 7.8 >SPBC1105.08 |||EMP70 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 629 Score = 26.6 bits (56), Expect = 2.6 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +1 Query: 10 IMKTFIVFVVCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGD-FKTENEPL 186 I+ TF++FVV ++L + L ++ K+ + + + E KL GD F+ P+ Sbjct: 274 IIDTFLIFVVSIILYRTL----NRDINKYNSAFVDQEDVQEDFGWKLVHGDVFRPPRRPM 329 >SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10 |Schizosaccharomyces pombe|chr 1|||Manual Length = 848 Score = 25.8 bits (54), Expect = 4.5 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +1 Query: 46 VLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYA 198 V + +TD N+ + L E + + ++K KT DFK + + YA Sbjct: 621 VASDKITDSSPGNMSEASESELEEVFKNPKELSKKKTTDFKDKEYYMSHYA 671 >SPAC1039.04 |||nicotinic acid plasma membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 507 Score = 25.4 bits (53), Expect = 5.9 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +1 Query: 22 FIVFVVCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFK 168 F+V V V A LTDE+K L K R + S + E+L K FK Sbjct: 238 FLVLPVSVETANFLTDEEK-TLAKMRIENDSSSAISEKLSFKQSLTVFK 285 >SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 230 Score = 25.0 bits (52), Expect = 7.8 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -2 Query: 305 LLYFQFVFSIRHFSQSDSFLNFPS---LVISCDLISIHRAYFFNGSFSVLKSPVFSL 144 LL+F F+ FS S SFL F S +V +H +FF V S +FSL Sbjct: 117 LLFFFFLLFFLSFSFSFSFLFFLSQIFIVYFSSFPILHFLFFFFLCVCVFLSFLFSL 173 >SPAC24H6.06 |sld3|mug175|DNA replication pre-initiation complex subunit Sld3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 668 Score = 25.0 bits (52), Expect = 7.8 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 421 IQPNRSIPH*C*IARTCLSRRYHDY 495 + P ++P C R C+S+ YH++ Sbjct: 26 VWPLVTVPRQCICLRWCISKEYHEF 50 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,262,223 Number of Sequences: 5004 Number of extensions: 46024 Number of successful extensions: 132 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 242064240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -