BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0764 (552 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g26100.2 68416.m03250 regulator of chromosome condensation (R... 27 6.3 At3g26100.1 68416.m03251 regulator of chromosome condensation (R... 27 6.3 >At3g26100.2 68416.m03250 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 532 Score = 27.5 bits (58), Expect = 6.3 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 304 HHITFGN-GNKHGNVYSLTRLSSCK*IAHLIVIVTENVYIYY 426 HH +F GN+H NV S T ++S K + +V ++ IY+ Sbjct: 445 HHPSFDEQGNRHANVLSPTVVTSLKQVNERMVQISLTNSIYW 486 >At3g26100.1 68416.m03251 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 432 Score = 27.5 bits (58), Expect = 6.3 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 304 HHITFGN-GNKHGNVYSLTRLSSCK*IAHLIVIVTENVYIYY 426 HH +F GN+H NV S T ++S K + +V ++ IY+ Sbjct: 345 HHPSFDEQGNRHANVLSPTVVTSLKQVNERMVQISLTNSIYW 386 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,292,188 Number of Sequences: 28952 Number of extensions: 184438 Number of successful extensions: 358 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 358 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -