BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0759 (589 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe... 71 1e-13 >SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 273 Score = 71.3 bits (167), Expect = 1e-13 Identities = 39/97 (40%), Positives = 57/97 (58%), Gaps = 2/97 (2%) Frame = +1 Query: 304 LSPNIEIGRI*PPSRITP--FNPFQIPLLNTIILIRSGVTVT*AHHSLIENNFSQTKQRL 477 LSP E+G + PP I +P ++PLLNT+IL+ SG ++T AH+SLI N + L Sbjct: 116 LSPTFELGAVWPPVGIADKTIDPLEVPLLNTVILLTSGASLTYAHYSLIARNRENALKGL 175 Query: 478 FLTILLGFYFIFYKHIEYIEGFPFTIAG*EFMGSHFF 588 ++TI L F F+ + EY PFTI+ + S +F Sbjct: 176 YMTIALSFLFLGGQAYEYWNA-PFTISDSVYGASFYF 211 Score = 26.6 bits (56), Expect = 2.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 164 RDISREGTYQGKHTILVNKGLR*G 235 RD+S E G HT V KGL+ G Sbjct: 69 RDMSTEANIHGAHTKAVTKGLKIG 92 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,859,618 Number of Sequences: 5004 Number of extensions: 28899 Number of successful extensions: 51 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 254167452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -