BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0758 (614 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_24758| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-10) 28 6.9 SB_38071| Best HMM Match : ABC_membrane (HMM E-Value=1.2e-11) 28 6.9 >SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -3 Query: 201 SMVRFQS*SRLSSVCSPIVHQLSSRRDSRLCVSSSSPSAHL*GP 70 S + +S S SSVC ++H+LS+ R +C S A+ P Sbjct: 430 SYIVCRSISYTSSVCRSVIHRLSANRSKTVCRSIGHTGAYTGAP 473 >SB_24758| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-10) Length = 367 Score = 27.9 bits (59), Expect = 6.9 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -1 Query: 149 LFISFRLG--ETVGSVFLQVLLLLICEGLSQDNADDEHDK 36 LF++F G E VG F+ L CE D DD+H++ Sbjct: 305 LFLAFNRGYRELVGRAFIYTCCTL-CEIAEDDENDDDHER 343 >SB_38071| Best HMM Match : ABC_membrane (HMM E-Value=1.2e-11) Length = 1214 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +3 Query: 201 KKYALCMLIKSQLMTKDGNSRRTSLWLKCLMLK 299 ++ ALC +I+++L+TKDG S + + C L+ Sbjct: 1175 RRNALCEVIENRLVTKDGRSLSQAGRILCYRLR 1207 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,657,325 Number of Sequences: 59808 Number of extensions: 323275 Number of successful extensions: 894 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 894 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -