BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0752 (561 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1703.02 |rsc9||RSC complex subunit Rsc9|Schizosaccharomyces ... 27 1.9 SPAC12B10.01c ||SPAC31F12.02c, SPAC637.15c|ubiquitin-protein lig... 27 2.5 SPAC513.06c |||dihydrodiol dehydrogenase |Schizosaccharomyces po... 25 7.6 SPBC543.04 |||UPF0171 family protein|Schizosaccharomyces pombe|c... 25 7.6 SPAC9G1.08c |||phospholipase |Schizosaccharomyces pombe|chr 1|||... 25 7.6 >SPBC1703.02 |rsc9||RSC complex subunit Rsc9|Schizosaccharomyces pombe|chr 2|||Manual Length = 780 Score = 27.1 bits (57), Expect = 1.9 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 2/97 (2%) Frame = +1 Query: 73 NLRECMDFY--FQCCSMEANCDIMSIMAATLANGGICPITDEKVLRPDSVRNVLSLMHSC 246 +L EC+ + FQ + D+ I GI + VL SV N + + Sbjct: 284 SLAECLVYSLGFQVTKAKQVSDLTDISLCMDRAIGIALVLRNSVL---SVENAKHVAQTK 340 Query: 247 GM*TTLDSSLSKWDSLPNLEYRAPCLLWSQMLWAYVH 357 + + L++S+ + NLE+ CL S+M+ +Y+H Sbjct: 341 LVISVLEASIRCAKTFNNLEFLHYCLDISEMISSYLH 377 Score = 25.8 bits (54), Expect = 4.4 Identities = 24/100 (24%), Positives = 40/100 (40%) Frame = +1 Query: 22 YALGFYMREHKCYPEKTNLRECMDFYFQCCSMEANCDIMSIMAATLANGGICPITDEKVL 201 Y+LGF + + K + T++ CMD + N + A +A + E + Sbjct: 291 YSLGFQVTKAKQVSDLTDISLCMDRAIGIALVLRNSVLSVENAKHVAQTKLVISVLEASI 350 Query: 202 RPDSVRNVLSLMHSCGM*TTLDSSLSKWDSLPNLEYRAPC 321 R N L +H C + + SS + N+ Y A C Sbjct: 351 RCAKTFNNLEFLHYCLDISEMISSYLHVEDEKNVFYLALC 390 >SPAC12B10.01c ||SPAC31F12.02c, SPAC637.15c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1647 Score = 26.6 bits (56), Expect = 2.5 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 100 NKSPYIPSDLFSRGSICVPSCKNPEHS 20 N+ PY+P D CV K PE+S Sbjct: 1598 NEPPYVPDDYLPSVMTCVNYLKLPEYS 1624 >SPAC513.06c |||dihydrodiol dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 368 Score = 25.0 bits (52), Expect = 7.6 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +1 Query: 91 DFYFQCCSMEANCDIMSIMAATLANGGICPITDEKVLRPDSVRN 222 DF F+ E+ +S+ A L + G+ P+T ++L D +N Sbjct: 173 DFRFRELPSESRLRTVSLGAGVLLDMGVYPLTWSRLLLYDDPKN 216 >SPBC543.04 |||UPF0171 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 585 Score = 25.0 bits (52), Expect = 7.6 Identities = 10/30 (33%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 402 VSLCSY-FPMDLEAVTMYICP*HLGPQ*AW 316 + LC+ F + ++ +T CP H+GP W Sbjct: 90 IELCNQKFEIWVDGLTFLGCPVHIGPNGEW 119 >SPAC9G1.08c |||phospholipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 241 Score = 25.0 bits (52), Expect = 7.6 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = +1 Query: 136 MSIMAATLANGGICPITDEKVLRPDSVRNVLSLMHSCGM*TTLDSSLSKWDSLPNLEY 309 MS + + L + I + K D V NV+ LMH G ++++K LPN Y Sbjct: 1 MSSLNSVLPSNACAEIIEGK----DKVHNVVILMHGLGDSHKSFANMAKNVPLPNTSY 54 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,543,688 Number of Sequences: 5004 Number of extensions: 52495 Number of successful extensions: 144 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 236012634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -