BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0752 (561 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram nega... 25 1.3 AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram nega... 25 1.3 EF492429-1|ABP35929.1| 155|Anopheles gambiae lysozyme i-2 protein. 25 2.2 AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced ... 24 3.9 AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 23 5.2 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 23 5.2 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 23 5.2 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 23 5.2 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 23 5.2 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 23 5.2 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 6.8 AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 23 9.0 AM182453-1|CAJ65691.1| 168|Anopheles gambiae globin 1 protein. 23 9.0 AM182452-1|CAJ65690.1| 168|Anopheles gambiae globin 1 protein. 23 9.0 AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 23 9.0 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 23 9.0 >AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 25.4 bits (53), Expect = 1.3 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -2 Query: 344 HNIWDHNKHGARYSRFGRESHFESELS--RVVYMPQLCIN 231 HN+ + +HG R + F +E HF L+ V + P N Sbjct: 306 HNLENPWRHGTRMAPFDQEFHFIINLAVGGVAFFPDAATN 345 >AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 25.4 bits (53), Expect = 1.3 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -2 Query: 344 HNIWDHNKHGARYSRFGRESHFESELS--RVVYMPQLCIN 231 HN+ + +HG R + F +E HF L+ V + P N Sbjct: 306 HNLENPWRHGTRMAPFDQEFHFIINLAVGGVAFFPDAATN 345 >EF492429-1|ABP35929.1| 155|Anopheles gambiae lysozyme i-2 protein. Length = 155 Score = 24.6 bits (51), Expect = 2.2 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +2 Query: 281 SGTPCQIWSIGRHAYCGPKCYGHMYMVTASRSI 379 + T C + R +YCGP Y + A R + Sbjct: 36 ASTGCSTSTTCRQSYCGPFSISRAYWMDAGRLV 68 >AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced homeotic protein protein. Length = 372 Score = 23.8 bits (49), Expect = 3.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -2 Query: 359 PCTYAHNIWDHNKHGARYS 303 P TYA NI+ H A YS Sbjct: 48 PSTYAPNIYPGTPHQAHYS 66 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 5.2 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = +1 Query: 16 RNYALGFYMREHKCYPEKTNLRECMDFYFQCCSMEANCDIMSIMAATLAN 165 +N A+ + + K Y +K+ L + DF++ +N D ++ L N Sbjct: 178 KNSAVLSFFNDEKLYLDKSGLLKEADFHYDVFVSYSNADRSWVLDHLLPN 227 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 5.2 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = +1 Query: 16 RNYALGFYMREHKCYPEKTNLRECMDFYFQCCSMEANCDIMSIMAATLAN 165 +N A+ + + K Y +K+ L + DF++ +N D ++ L N Sbjct: 178 KNSAVLSFFNDEKLYLDKSGLLKEADFHYDVFVSYSNADRSWVLDHLLPN 227 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 5.2 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = +1 Query: 16 RNYALGFYMREHKCYPEKTNLRECMDFYFQCCSMEANCDIMSIMAATLAN 165 +N A+ + + K Y +K+ L + DF++ +N D ++ L N Sbjct: 178 KNSAVLSFFNDEKLYLDKSGLLKEADFHYDVFVSYSNADRSWVLDHLLPN 227 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 5.2 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = +1 Query: 16 RNYALGFYMREHKCYPEKTNLRECMDFYFQCCSMEANCDIMSIMAATLAN 165 +N A+ + + K Y +K+ L + DF++ +N D ++ L N Sbjct: 178 KNSAVLSFFNDEKLYLDKSGLLKEADFHYDVFVSYSNADRSWVLDHLLPN 227 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 5.2 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = +1 Query: 16 RNYALGFYMREHKCYPEKTNLRECMDFYFQCCSMEANCDIMSIMAATLAN 165 +N A+ + + K Y +K+ L + DF++ +N D ++ L N Sbjct: 178 KNSAVLSFFNDEKLYLDKSGLLKEADFHYDVFVSYSNADRSWVLDHLLPN 227 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.4 bits (48), Expect = 5.2 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = +1 Query: 16 RNYALGFYMREHKCYPEKTNLRECMDFYFQCCSMEANCDIMSIMAATLAN 165 +N A+ + + K Y +K+ L + DF++ +N D ++ L N Sbjct: 405 KNSAVLSFFNDEKLYLDKSGLLKEADFHYDVFVSYSNADRSWVLDHLLPN 454 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 6.8 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -2 Query: 215 TESGRNTFSSVIGQIPPLAKVAAIIDIISQFASMEQHWK 99 T +G+ TFS++IG P +I Q E+ K Sbjct: 538 TNAGKTTFSNIIGSSGPSVTSCTGSEIDKQVGLWERRVK 576 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 22.6 bits (46), Expect = 9.0 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +3 Query: 114 HGSKLRYNVNYGG 152 HG+KL+ V+YGG Sbjct: 274 HGTKLKVCVSYGG 286 >AM182453-1|CAJ65691.1| 168|Anopheles gambiae globin 1 protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 504 HRLNIVNFIGLL 539 H LN++NFIG L Sbjct: 86 HALNVMNFIGTL 97 >AM182452-1|CAJ65690.1| 168|Anopheles gambiae globin 1 protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 504 HRLNIVNFIGLL 539 H LN++NFIG L Sbjct: 86 HALNVMNFIGTL 97 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 22.6 bits (46), Expect = 9.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -3 Query: 127 SLLPWNSTGNKSPYIPSDLFSRGS 56 SLL WN T + +P+D+ + G+ Sbjct: 117 SLLRWNVTAHFLNLLPADVMTLGN 140 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 22.6 bits (46), Expect = 9.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -3 Query: 127 SLLPWNSTGNKSPYIPSDLFSRGS 56 SLL WN T + +P+D+ + G+ Sbjct: 117 SLLRWNVTAHFLNLLPADVMTLGN 140 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,188 Number of Sequences: 2352 Number of extensions: 14498 Number of successful extensions: 80 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -